KEGG   Nocardia brasiliensis: O3I_009930Help
Entry
O3I_009930        CDS       T02270                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00970  Aminoacyl-tRNA biosynthesis
nbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    O3I_009930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nbr03029]
    O3I_009930
Enzymes [BR:nbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     O3I_009930
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     O3I_009930
Mitochondrial biogenesis [BR:nbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    O3I_009930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFT99946
UniProt: K0EQX7
LinkDB All DBs
Position
complement(2252989..2254374)
Genome map
AA seq 461 aa AA seqDB search
MQPYELTLADASAAMQAGQLSPVELVDSILDRIEHVEPLLGAYVTVTTDRARTAARQAER
EIAQQRTRGALHGIPVALKDLIDVAGLPTTASSRVRAGHRAETDSAVTTRLAAAGTALLG
KTHTHEFAYGLTTPQTRNAWNLERVAGGSSGGSAVAVAASAATFALGTDTGGSIRVPAAL
NGVVGLKPTYGLVSRHGVTALSWSLDHVGPITRTVADATLALTALAGPDPRDPASLSHTA
DYRLDTDIDLRGLRIGVPVNYYFDRVEPGIETAVRAAIDHLSGLGAELVEIEIPMTRYIK
AIQWGLMVPEASAVHENSLRSTPDRYGPDVRNLLEAGTFLPAADYLRAQRARTLLREAVI
RLFNDVDLIAAPTVPATAARAGQDEFHWPDGTVETVADGYVRLSAPANITGIPAMTIPVG
HDPAGLPIGMQLMTRPLGEPLLLRAGHAYERTTVRQPLPVL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgtatgagctgacgcttgccgacgcgtccgccgcgatgcaggccggccaactt
tcaccggtcgaactcgtggattcgatactggaccgcatcgagcacgtcgagcccttgctc
ggtgcgtatgtgacggtgacaaccgaccgtgcgcgcacggcggcacggcaggccgagcgg
gaaattgcgcaacaacggacgcgtggggcattgcacggcatcccggtcgcgctgaaagac
ctgatcgacgtcgccgggctaccgaccacggcgagttcgcgcgtccgggcaggccaccga
gccgagaccgacagtgccgtcacgacccgcttggccgcagcgggcaccgccttgctcggc
aaaacccacacgcacgagttcgcgtacggcctgaccacaccccagacgcgcaacgcttgg
aacctcgagcgggttgccggcggctcgagcggcggttccgcggtcgcggtcgcggcgagc
gcggcgaccttcgccctcggcaccgataccggcggctccatccgggtgcccgccgccctc
aacggcgtggtcgggttgaagccgacctacggcctggtctcccgacacggcgtcaccgcg
ctgtcctggtcactggatcacgtcggaccgatcacccgcaccgtcgccgacgcgacgctg
gccctcaccgccctagccggcccagacccccgcgacccggccagtctgtcccacaccgcc
gactatcgactcgacaccgatatcgacctgcgcggtctgcgcatcggcgtgcccgtgaac
tactacttcgaccgcgtcgagcccggcatcgagaccgccgtacgggccgctatcgaccac
ctgtccggactgggtgccgagctcgtcgagatcgagatcccgatgacccgctacatcaaa
gcgatccaatggggactgatggtgccggaagccagtgccgtgcacgaaaattcgttgcgc
agcacacctgaccgctatggtccggacgtccggaacctgttggaggcaggcacatttctc
ccggcagccgactacctgcgcgctcagcgcgcccgaaccctcttgcgagaagccgtcatc
cgcctcttcaacgacgtcgacttgatagccgcaccgaccgtccccgcaactgccgcccgc
gccggacaggacgaattccattggcccgacggcacagtcgagaccgtcgccgacggctac
gtgcggctctcggcaccggcgaacatcaccggaatccccgccatgaccatcccagtcgga
cacgacccggccggtctgccgatcggcatgcagctcatgacccggcccctcggtgagccg
ttgctgctgcgagccgggcacgcctacgagcgcaccaccgttcgtcagccgctaccggtg
ctgtga

DBGET integrated database retrieval system