KEGG   Nocardia brasiliensis: O3I_019280Help
Entry
O3I_019280        CDS       T02270                                 

Definition
(GenBank) acyl transferase
Organism
nbr  Nocardia brasiliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C NAD_binding_4 Epimerase adh_short KAsynt_C_assoc PikAIV_N GDP_Man_Dehyd PP-binding Thiolase_N Polysacc_synt_2 NAD_binding_10 NmrA 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: AFU01815
UniProt: K0EY99
LinkDB All DBs
Position
complement(4321854..4328273)
Genome map
AA seq 2139 aa AA seqDB search
MNTSVDELVEALRESLKENERLKARISEPIAIIGMACRFPGGVRSPEELWELLAADGDAI
APFPTDRGWDTGTLYHPDPEHPGTTYVRAGGFLRDAALFDAGFFGITPREAAAINPQQRL
LLECAWESLEHAAIDPTALVGSRTGVFAGVIYQDYSLPLQAPPHDAEGYLLTGELGSVAS
GRIAYTLGLQGPAVTIDTACSSSLVALHAAAASLRRGECSLALAGGATVMCHPRVITEMS
RQGGLAPDGRSKPFSDNADGAGWGEGVGMLVLERLSDARANGHEILAVLRGSAINSDGAS
NGLTAPNGPSQQRVIRDALHACDLSPAEVDAVEAHGTGTALGDPIEAGALIAAYGAGRPA
QRPLWVGSVKSNIGHPQAAAGVAGVIKMVLAMRHETLPALVHFTTPSRHVDWAEAGVRPL
AEAVPWPRGERVRRCGVSSFGISGTNAHVILEEAPVATAATEPSGPPAEVTPWVVTARSA
AALSAQAAALLTAAATERPEDLGFSLALNRSRFDHRAVVVGADRDELLTGLTALSRDESA
PQVVRGTAWPDPRPVFVFPGQGGQWPEMAAALVKSSPVFAQSLAECGDALARYVPWSLHD
VLDNVAGAPSLDRVDVVQPVLWAVMVALARVWQAYGVEPAAVVGHSQGEIAAACVAGALS
LDDGALIVTRRSRAVLPLSGTGAMLSLGLGAAAARERMARFGTRLSVAAANGPESTVVCG
EPDAIAELQAECAAAGVHTRTINADYASHSSHVDPLEPELLDALARVRPRTGSVPMISTV
TGAPIEHTALDATYWWQNLRRPVEFETATRQLLTAGHHVFIEISPHPVLAFGIEGTVEAT
RAEAAVVATLRRDDGGLDRMTTALAQAHAYGVPVDWDAYFAPTRPRRIPLPTYAFQRQRY
WLTDAPRTGPADLTAAGLERPAHPLIGAGVQLADTEGHLFTASLSLERQPWLADHTVGGE
VILPGTAMVELALRAGEQVGAEWVDELVLEAPLVLPGDDTVQVQLTVGAVDDTGGRRVSL
YSRRGGLGAWTRHAHGTVSPTWEPPADGFAEWPPTGAAPMDVDAVYDRAAQAGMTYGPAF
RGLNRLWRSGAEYYLESRLPDEIAMDAGQYGLHPALTDAVLHGCLAALADRNALTHAAVL
PFTWTGVGLYTLGAAAVRARITPLGDTEFRVDLADDAGEAVGQIATLSFRPAGSLLQGAT
QALSTVRWTSLAAPADTGPGDELWVLGDDLARQLADAGIEFGRCADATAVNSSGPVLLDV
APVATPAGVARAALDRVRQVLSDIRAWLAATGDPAARLAVITHRAVAITPDEDVTDLASA
AVWGLIRTAQAEYPGRFVLVDLDDEPASARALPSALRTAEEQLAIRDGHLSTPRIGPLRT
EATAPPLAEPDHTVLITGGTGGLGGLLARHLATAHHVRHLLLVSRRGETSPGAAELVAEL
TALGAEVRVAACDIADYAATAELLRSLPADRPLGAVIHAAGVLDDGTVETLTDAQIERVM
RAKVDGAVNLHLLTEGLELSGFLTYSSVAGVLGTPGQANYAAGNAFLDALVQHRRAHGLP
GISLAWGPWASDAGMTEGLSEVDHARLGRWGLLPLDAADGCALFDAARAADRPLAIPCRI
QLTRAGDAQLVPAMLRDMVRAAPRPRQATSAPRADDTAREREQLRDHLIGLPAVQRREEL
VRMITRHAAEVANLASADEVAADLPLMALGFDSLASLELRNRLVHQLGLTGHLSANAVFQ
TPTPAGLAARIATILTGDDESTAVEEPVPDQVGLPDDIVPAATSGPVALAAAAHLFVTGA
TGFVGSFLVRELLDRTSSTVHCLVESPNAAQGLAQLRDTMRGYRLWDDAIADRLIVVPGR
LTDPHFGLTEREFDALARTVDGVFHCAAVVDESESVDGMAAVLRLAARHRTVPVHHLSTF
AVFGPPDTAGPAPAEDAPTGPSAALTDEYAQAGWIAEEMAARARERGLPISIYRLPPTDL
LWRVVQGCIQAGVAPATELTGDIIPVGYAAKAIAALSCDGKAAGATFHLSSPEPVPFASI
IATLAARGYPLAELPAGLWADMIAGDPDNAAHPVLQAFSEIAFEQPDHGRSSFESTATRA
ALTSVGVSGPPASAASLAATIDYFIETGHLPAAQEASTR
NT seq 6420 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacatccgtcgacgaactggtcgaggcgctgcgcgagtcgctgaaggagaacgag
cggctgaaagcgcggatcagcgaaccgatcgcgatcatcggcatggcgtgccgctttccc
ggcggcgtgcgctcgcccgaggaactctgggagctgctggccgccgacggtgacgcgatc
gcgcccttccccaccgaccgcggctgggacaccggcaccctctaccaccccgatccggag
caccccggcacgacctacgtgcgcgcaggcggattcctgcgggacgcggcgcttttcgac
gccgggttcttcgggatcacaccgcgcgaggccgccgcgatcaatccgcagcagcgcctg
ctgctcgaatgcgcttgggaatccctcgaacacgccgccatcgatccgaccgccctggtc
ggcagtcgcaccggcgtcttcgccggcgtgatctaccaggactacagcctgccgctgcag
gcaccgccgcacgacgccgaaggatatctgctcaccggcgaactcggcagcgtcgcgtcc
ggccggatcgcctacacgctgggtttgcagggccccgcggtcaccatcgacacggcgtgc
tcgtcgtcgctggtcgcgctgcacgcggccgccgcttcgctacgtcgtggcgaatgctcg
ctcgcgctggcgggcggcgcgacggtgatgtgtcacccgcgggtgatcaccgagatgtcc
cggcagggcgggctggcgccggacggccgctcgaagccgttctccgacaacgccgacggg
gccgggtggggcgagggcgtcggcatgctcgtcctggagcgactgtccgacgcccgcgcg
aacgggcacgagatactcgcggtgctgcgcggctcggcgatcaactccgacggcgcgagc
aacggcctgaccgcgcccaacgggccctcccagcaacgggtcatccgcgacgcactgcac
gcctgcgacctctcccctgccgaggtggacgcggtggaggcgcacgggacgggcaccgca
ctcggtgacccgatcgaggccggcgctctcatcgccgcctacggtgccggccgcccggcg
cagcggccgctgtgggtcggcagcgtgaagtcgaacatcggtcatccgcaggcggccgcc
ggcgtggccggggtgatcaagatggtgctggcgatgcgccacgaaaccttgcccgcgctg
gtgcatttcacgacgccgtcccggcatgtggactgggctgaggcgggtgtccggccactc
gccgaagcggtgccgtggccacgcggcgaacgggtacggcggtgcggggtgtcctcgttc
ggtatcagcggcacgaacgcacacgtgatcctcgaggaagctccggtggcgacggccgcc
accgagccgagtggcccaccggccgaggtgacgccgtgggtggtcaccgcgcgcagtgcc
gcggccctgtccgcgcaggccgcggccctgctgaccgcagcggcgaccgaacgtcccgag
gacctcggattctccttggcgctcaaccgctctcggttcgaccatcgggccgtggtggtc
ggcgccgaccgagacgaactgctcaccggactcacggcgctctcgcgcgacgagtccgcg
ccgcaagtggtgcgcgggaccgcctggccggacccgcgtccggtgttcgtattccccggg
cagggcggtcagtggccggaaatggcagcggcgctggtgaagtcgtcgccggtgttcgca
cagagcttggccgaatgcggtgacgcgctggcccgatacgtcccgtggtcgttgcacgat
gtcctcgacaatgtcgcgggcgcaccgagtctcgatcgggtcgatgtcgtgcagccagtg
ctctgggccgtgatggtcgcattggcacgggtgtggcaggcctatggcgtcgaacccgct
gcggtggtgggacattcccagggcgagatcgccgccgcctgcgtggcgggcgcgctgtcc
ctggacgacggcgcgctcatcgtgacgcgacgcagccgagcggtcctgccgctgtcgggc
accggcgcgatgctctcgctcggcctgggcgcggccgcggcacgggaacgtatggcacgg
ttcggcactcggctgtcggtcgccgcggcgaacgggcccgagtcgacggtggtctgcggc
gaaccggacgcgatcgcggagctacaggccgaatgcgcggccgccggcgtgcacacccgg
accatcaacgcggactacgcctcgcacagcagtcacgtggacccgctcgaacccgagctg
ctcgacgcgctcgcccgggtgcggccgcgcaccggatcggtgccgatgatttccacggtc
accggcgcgccgatcgagcacaccgcgctcgacgcgacctactggtggcagaatctgcgc
aggccggtcgaattcgagaccgccacccgtcagctgctgaccgcaggacatcacgtcttc
atcgagatcagcccgcatccggtgctcgccttcggcatcgaaggcaccgtcgaggcgacc
cgggcggaggcggccgtggtcgccaccctgcgccgcgacgacggcggtctcgatcgcatg
accaccgccctcgcccaggcgcacgcgtacggcgttcccgtcgactgggacgcctatttc
gcaccgactcgaccgcgccgaatccccctgcccacctatgccttccagcgccagcgctac
tggctcaccgacgcgccgcgcaccggaccggccgacctcaccgcggcggggctcgaacgg
ccggcccacccgctgatcggcgcgggcgtgcaactcgccgacaccgaggggcacctgttc
accgcgagcctgtcgctggagcgccagccctggctggcggaccacacggtcggcggcgag
gtgatcctgccgggcaccgcgatggtcgaactcgctttgcgggcaggcgaacaggtgggc
gccgaatgggtggacgagctggtgctcgaggctccgctggtgctgcccggcgacgacacg
gtccaggtccagctcaccgtcggtgcggtggacgacacgggcggacgacgggtcagcctg
tactcccggcgcgggggcctcggcgcgtggacccggcacgcgcacggcacggtgtccccc
acctgggagccgccggccgacggattcgccgagtggccacccaccggcgccgcaccgatg
gacgtggacgccgtctacgaccgcgcggcacaggcgggtatgacgtacgggcccgccttc
cgcggcctgaaccggttgtggcgcagcggtgccgagtactacctcgaatcgcgactaccg
gacgaaatagccatggacgccgggcagtacggtctgcaccctgccttgaccgacgccgtg
ctgcacggctgcctcgccgccctggccgaccggaacgcgctcacgcacgcggcggtcctg
ccgttcacctggacgggggtcggcctgtatacgctcggtgcggcagcggtccgggcccgc
atcacgcctttgggcgacaccgagttccgcgtcgatctcgccgacgacgcgggcgaggcc
gtcggccagatcgcgacgctgagcttccggcccgccgggtctctgctacagggcgcgacc
caggcactgtccacggtccgctggacctcgctggccgcacccgccgataccggacccggc
gacgagctgtgggtgctcggcgacgacctcgcccgccaactcgccgacgccggaatcgaa
ttcggtcgctgcgccgatgccaccgccgtgaacagctcgggtccggtgttgctcgacgtc
gccccggtcgccacccccgccggagtggcccgtgccgcgctcgaccgcgtgcggcaggtg
ctgtccgatatccgggcgtggctcgcggccaccggcgacccggcggcacggctcgcggtg
atcacccatcgtgcggtcgccatcacacccgacgaggacgtcaccgatctggcgagcgcc
gcggtctggggactgatccgcaccgcacaggccgaataccccggccgattcgtcctggtg
gatctcgatgacgaacctgcctccgcgcgggcgttgccgtcggcgctgcgcaccgccgag
gagcagctcgcgattcgcgacggtcatctgagtaccccgcggatcggcccgctgcgcacc
gaagccaccgcgccaccgctggcggaacccgaccacacggtgctgatcaccggcggcacc
ggcggactcggcggactcctcgcgcgccacctcgcgaccgcgcaccacgtccggcacctg
ctcctggtcagccggcgcggcgaaacatcgcccggcgcagccgaactcgtcgccgaactg
accgcactcggcgccgaggtccgggtggcggcgtgcgatatcgccgactacgcggccacc
gccgagctgctgcgctcgctgcccgccgatcggccgctcggcgcggtgatccacgcggcc
ggggtgctcgacgacggcaccgtcgagacgctcaccgacgcccagatcgagcgcgtcatg
cgcgccaaggtggacggcgcggtgaatttgcatctgctcaccgagggcctcgagttgtcc
ggcttcctgacctactcctcggtggcgggtgtgctcggcacgccggggcaggccaattac
gcggcaggcaacgccttcctggacgcgctcgtgcagcaccgccgcgcgcacggcctgccg
ggcatctcgctggcgtgggggccgtgggcgagcgacgcgggcatgaccgagggtctgtcc
gaggtggaccacgcccgcctgggccggtggggactgcttccgctcgacgccgcggacggc
tgcgcgctcttcgacgcggcccgcgccgcggaccggccgctcgccattccctgccgcatc
cagttgaccagagctggtgacgcacagcttgttccggcaatgctgcgcgacatggtccgg
gccgcgcctcggccccgccaggccacgagcgcacccagggcggacgacaccgcacgcgaa
cgcgagcagctgcgggaccacctgatcggtttgcccgcggtccagcgaagagaagaactg
gtccggatgatcacccggcacgccgccgaggtcgccaatctggcctcggccgacgaggtc
gccgccgatctgccgctgatggcgctcggtttcgattcgctcgcctcgctcgaactgcga
aatcgcctggtgcatcagctcggattgaccgggcacctgtccgcgaacgccgtcttccag
acgccgacgccggccggcctcgccgcgcggatcgccacgatcctgaccggtgacgacgaa
tccaccgcggtcgaagaaccggtgccggaccaggtggggttgcccgacgatatcgtgccc
gccgcaacctccggcccggtcgccctggccgccgccgcacatctcttcgtcacgggcgca
accggattcgtcggcagcttcctggtccgtgaactgctggaccggacgtcgtcgaccgtg
cactgcctcgtcgagtcgccgaacgcggcgcagggcctggctcagctgcgggacacgatg
cgcggctaccggctgtgggacgacgcgatagccgaccgactgatcgtggtgcccggcagg
ctcaccgatccccatttcggcctgacggagagggagttcgatgcgctggcccgcaccgtg
gacggcgtattccattgcgccgcagtcgtggacgaatccgagtcggtggacgggatggcg
gccgtcctacgcctggccgcccgccaccggacggtcccggtgcatcacctgtccacgttc
gccgtcttcgggccgccggacaccgccgggcccgcaccggccgaggacgcgccgaccggc
ccgtcggccgcgctgacggacgagtacgcgcaggccgggtggatcgcggaggaaatggcc
gcccgcgcccgcgaacgcgggctacccatctcgatctaccggttgccgccgaccgatctg
ctctggcgcgtcgtccaagggtgcatccaggcgggcgtagcgcccgcgaccgagctgacc
ggcgacatcatccccgtcggctacgcggcgaaagccattgccgccctgtcctgcgacggc
aaggcggccggcgcgaccttccacctgtccagcccggaaccggtgccgttcgcatcgatc
atcgccacgctcgccgcccgcggatacccgctggccgaactccccgcgggactgtgggcg
gacatgatcgccggcgatccagacaacgccgctcatccggtgctgcaagccttctcggag
atcgccttcgagcaacccgaccacggccgctcatcgttcgagtccaccgcgacccgggcg
gcgctcacgtcggtcggcgtatccggtccacccgcgagtgccgcgtcactggccgcgacc
atcgactatttcatcgagacgggccacctgcccgccgcacaggaggcttcgacacgatga

DBGET integrated database retrieval system