KEGG   Nocardia brasiliensis: O3I_019290Help
Entry
O3I_019290        CDS       T02270                                 

Definition
(GenBank) alcohol dehydrogenase zinc-binding domain-containing protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00040  Pentose and glucuronate interconversions
nbr00051  Fructose and mannose metabolism
nbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    O3I_019290
   00051 Fructose and mannose metabolism
    O3I_019290
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     O3I_019290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFU01817
UniProt: K0EWI9
LinkDB All DBs
Position
complement(4331430..4332386)
Genome map
AA seq 318 aa AA seqDB search
MGNEPPPAAAAGETLVRVTAVGICGSDLHWYEDGAIGDAKLGEPLIPGHEGAGEIVTGPR
RGERVAIDPAIPCEACRACRDGYRNLCYHVRFAGHGVTDGMLREILPWPTHRLHPLPDNV
SDAAGALLEPLAVALWALDLGPVPFGGTAAVVGCGPVGLLLIQVLRAAGVSRVLAVEPLA
HRRDAAAKWGADEILDPYPAADPPDFAAHGVDVAFEMAGNDDAVHIAMAATRPGGRVVLG
GIPGSDTTTFRASLARGKELTIAMVRRSNETHPRAIDLAARGVVELDPLVSSRVPLTEAP
AAFADAQRRTGLKVIITP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggggaacgaaccaccgccggcggcggctgcgggcgagaccctggtacgggtcaccgcg
gtcggcatatgcggatcggatctgcactggtacgaagacggcgcgatcggcgacgcgaaa
ctcggggagccattgatacccggccacgagggcgcgggtgagatcgtcaccggaccgcgg
cgcggcgaacgggtcgcgatcgatccggcgatcccttgcgaggcctgccgcgcctgccgc
gacggttatcgaaatctttgctatcacgtgcgattcgccggccacggcgtgaccgacggg
atgctccgcgagatcctgccgtggccgacgcatcgcttacatccgttgccggacaacgta
tccgatgctgcaggagccctgctcgagccgctggcggtcgccctgtgggcgctggatctc
ggcccggtaccgttcggcggtaccgcggcggtcgtgggctgcgggccggtcggactgctg
ctgatccaggtgctgcgcgccgccggggtatcccgcgtgctcgcggtcgagccgctggca
caccggcgagacgccgccgcgaaatggggcgccgacgagattctcgatccctaccccgcc
gcggacccgcccgacttcgccgcgcacggcgtcgatgtcgccttcgaaatggccggaaac
gacgacgcggtgcacatcgccatggcggccacgcgaccgggcgggcgggtggtgctcggc
ggtatccccggctcggacaccacgacgttccgggcctcactcgcccgcggtaaagagctg
accatcgcaatggtgcggcgcagcaacgagacccacccgcgcgcgatcgatctggcggcg
cgcggcgtcgtcgaactcgacccgctcgtatcgtcgcgggttccgctcaccgaggccccc
gccgcgttcgccgacgcgcagcgccgcacggggctgaaagtcatcatcacgccgtaa

DBGET integrated database retrieval system