KEGG   Nocardia brasiliensis: O3I_030445Help
Entry
O3I_030445        CDS       T02270                                 

Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00250  Alanine, aspartate and glutamate metabolism
nbr00410  beta-Alanine metabolism
nbr00640  Propanoate metabolism
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    O3I_030445
   00650 Butanoate metabolism
    O3I_030445
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    O3I_030445
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3I_030445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nbr01007]
    O3I_030445
Enzymes [BR:nbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     O3I_030445
Amino acid related enzymes [BR:nbr01007]
 Aminotransferase (transaminase)
  Class III
   O3I_030445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFU04038
UniProt: K0EW28
LinkDB All DBs
Position
6914958..6916199
Genome map
AA seq 413 aa AA seqDB search
MTELSPVLRQATPVTVDHGAGCYLYGTDGRRYLDFTAGIGVTSTGHCHPHVVAAAQAQVG
SLIHGQYTTVMHRPMLQLIERLGTVLPAELDALFFANSGSEAIEAALRLARQATGRPNVV
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLMSGVHVAPFPTAFRYGWTEQEATEFALREL
DYLFATLTSPAETAAFVVEPMLGEGGYIPGNTAFFRGLRERADRHGILLVLDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAAARELMAKAWPGSQGGTYGGNAVACAA
AVATLEVIESEQLVDNAAARGTQLLDGLRASATKAIGDVRGLGLLAGAEFTTATGEPDTE
TASAAQRLAVEKGLLLLTCGAHMNVVRMIPPLIVTASQIDDALAIWTEVLAEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactttcgcccgttctgcgccaggccaccccggtgaccgtcgatcacggcgcc
ggctgctacctgtacggcaccgacggacgccgctacctcgacttcaccgccggcatcggc
gtcaccagcacgggccactgccacccgcacgtggtcgcggcggcccaggcccaggtgggc
agcctgatccacggccaatacaccaccgtcatgcaccggccgatgctgcagctcatcgag
cgcctcggcacggtcctgcccgcggaactggacgcgctgttcttcgccaactccggcagc
gaggcgatcgaagccgcgctgcggctcgcgcgccaggcgaccggacggccgaatgtcgtg
gtcttccacggcggtttccacggtcgcacggtcgcggcggccaccatgaccacgtccggc
acccggttctccgccggattcagcccgctcatgtccggcgtgcacgtggcgcccttcccg
accgccttccgctacggctggaccgaacaggaggcgaccgagttcgcgctgcgcgagctc
gactatctgttcgccacgctcacctcgcccgcggagaccgccgcgttcgtggtcgagccg
atgctcggcgaaggcggctacatccccggcaacaccgccttcttccgcggcctgcgcgaa
cgcgccgaccggcacggcatcctgctcgtgctcgacgagatccagaccgggttcggccgc
accggaaagttcttcgggcaccagcatttcgacgtgcgacccgacatcatcaccatcgcg
aaggggctcgccagcggcttcccgctctcgggtatcgcggccgcgcgcgagctgatggcc
aaggcctggcccggctcgcagggcggcacctacggcggcaacgccgtggcctgcgccgcg
gcggtggcgaccctggaggtcatcgaatccgagcagctggtggacaacgccgccgcccgt
ggcacgcaactgctcgacgggctgcgcgcgagcgccaccaaggcgatcggtgacgtgcgc
ggcctcggcctgctcgccggagccgaattcaccaccgcgaccggcgaacccgataccgag
acggcgagcgcggcgcagcggctcgcggtcgagaagggactgctgctgctcacctgcggc
gcgcacatgaacgtggtgcgcatgatccccccgctgatcgtcaccgcgagccagatcgat
gacgcgctcgcgatctggaccgaggtgctggccgaactctga

DBGET integrated database retrieval system