KEGG   Nocardia brasiliensis: O3I_038205Help
Entry
O3I_038205        CDS       T02270                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
nbr  Nocardia brasiliensis
Brite
KEGG Orthology (KO) [BR:nbr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nbr03012]
    O3I_038205
   03029 Mitochondrial biogenesis [BR:nbr03029]
    O3I_038205
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nbr04147]
    O3I_038205
Translation factors [BR:nbr03012]
 Eukaryotic Type
  Elongation factors
   O3I_038205
 Prokaryotic Type
   O3I_038205
Mitochondrial biogenesis [BR:nbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    O3I_038205
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   O3I_038205
  Exosomal proteins of breast cancer cells
   O3I_038205
  Exosomal proteins of colorectal cancer cells
   O3I_038205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFU05588
UniProt: K0F039
LinkDB All DBs
Position
complement(8596043..8597233)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLADKFPDLNDAFAFDQIDKAPEEKA
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKSDMVDDEEILELVEMEVRELLAAQEFDEDAPVVRVSGLKAL
EGDPKWTESVLELMNAVDESIPDPVRETDKPFLMPVEDVFTITGRGTVVTGRVERGIINV
NEEVEIVGIREKSTKTTVTGIEMFRKLLDQGQAGDNVGLLVRGIKREDVERGQVVVKPGT
TTPHTEFEGQAYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNTE
MSVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcgaagttcgagcggacgaagccgcacgtcaacatcggcaccatcggtcac
gtcgaccacggcaagaccacgctgactgcagcgatcaccaaggtgctggctgacaagttc
ccggatctgaacgacgcgttcgcgttcgatcagatcgataaggcgccggaggagaaggct
cgtggtatcacgatcaacatctcccacgtcgagtaccagacggaaaagcgccactacgcg
cacgtcgacgctccgggccacgcggactacatcaagaacatgatcaccggtgcggcgcag
atggacggtgccatcctcgtggtcgccgcgaccgacggcccgatgccccagacgcgtgag
cacgtgctgctcgcccgtcaggtcggcgtgccctacatcctggtcgcgctgaacaagtcg
gacatggtcgacgacgaggaaatcctcgagctcgtcgagatggaggtccgcgaactgctg
gccgcccaggaattcgacgaggacgcgccggtcgtgcgcgtctccggtctgaaggcgctc
gagggcgacccgaagtggaccgagtcggttctggaactgatgaacgccgtcgacgagtcg
atcccggacccggtccgcgagaccgacaagccgttcctcatgcccgtcgaggacgtgttc
accatcaccggtcgtggcaccgtcgtcaccggtcgtgtcgagcgcggcatcatcaacgtg
aacgaggaagtcgagatcgtcggcatccgcgaaaagagcaccaagaccaccgtcaccggt
atcgagatgttccgcaagctgctcgatcagggccaggcaggcgacaacgtcggtctgctc
gttcgtggtatcaagcgcgaagatgtcgagcgtggccaggtcgtcgtgaagccgggcacc
accaccccgcacaccgagttcgagggccaggcgtacatcctgtcgaaggacgagggcggc
cgccacaccccgttcttcaacaactaccgtccgcagttctacttccgtacgactgacgtg
acgggcgttgtgaccctgcccgagggcaccgagatggtcatgcccggtgacaacaccgag
atgtccgtcaagctgatccagccggtcgccatggacgagggtctgcgcttcgcgatccgc
gagggtggccgcaccgtcggcgccggtcgcgtcacgaagatcatcaagtga

DBGET integrated database retrieval system