KEGG   Nocardia brasiliensis: O3I_040760Help
Entry
O3I_040760        CDS       T02270                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
nbr  Nocardia brasiliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFU06097
UniProt: K0F8Q5
LinkDB All DBs
Position
9128986..9130431
Genome map
AA seq 481 aa AA seqDB search
MHYDSLFIGGRWTAPASTERVQVISPVTVEPVGSVPAVTRADVDAAVAAARHAFDHGPWP
ATPPQERAEVLTRAARLIEQRSAELLAALTAEMGAPQMIAMTLNQIPAVAALDACAALAK
TFPWNETRTGLFGTARVSREPRGVVAAVTAWNVPLFLAANKLGPALLAGCTVVLKPAPLT
PITANLLADIFTEAGLPEGVLSVLPAEPEAAEYLVSHPGVDKVTFTGSTAVGRKIGAIAT
GRLKSVSLELGGKSAAILLPDMDIAATIPVLAFSGLMNSGQGCVAQTRILAPRSRYDETV
DALVAHVRTMQVGDPADPAVQLGPLISERQRERVEGYIAKGKAEGARLVLGGGRPEGLDR
GWFVEPTIFADVDNKSTIAQEEIFGPVLSVIPYETEDEAVAIANDSVYGLAGSVWTTDVE
HGAEIAARVRTGTYAINWYAFDPSSPFGGYKNSGLGRENGPEGLDSFCEQKSVLMPMGWT
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcattacgacagcttgttcatcggcggccgctggactgcgccggcctccaccgagcgc
gttcaggtcatctcgccggtcacggtcgagccggtgggcagcgtccccgcggtcaccagg
gccgacgtcgacgcggcggtcgccgccgcccggcacgccttcgaccacggcccgtggccc
gctacgccgccacaggagcgggccgaagtactcacccgggccgcgcggctgatcgagcag
cgttcggccgagctgctcgccgcgctcaccgcggaaatgggcgcaccgcagatgatcgcc
atgacgctcaaccagattcccgcggtcgccgcgctggacgcgtgcgcggcactcgcgaag
acgttcccctggaacgagactcgcaccggactcttcggcaccgcgcgggtgagccgtgag
ccgcgcggagtcgtcgcggcggtcaccgcgtggaatgtcccgctgttcctcgccgccaac
aagctcggaccggccttgctcgccggttgcaccgtggtgctgaaacccgcaccgctgaca
ccgatcacggccaatctgctcgccgacatcttcaccgaggcgggcctgcccgagggcgtg
ctctcggtgctgcccgccgaacccgaggccgcggagtacctggtttcacatccgggcgtc
gacaaggtcaccttcaccggcagcaccgcggtcggccggaagatcggcgcgatcgccacc
ggccggctcaagagcgtgtccctggaactcggcggcaagtccgcggcaatcctgttgccg
gacatggacatcgcggccaccattcccgtgctcgccttctccgggctgatgaacagcggg
cagggttgcgtcgcgcagacccgaatcctcgcgccgcgcagtcgttatgacgagaccgtc
gacgcgctcgtcgcgcacgtgcggaccatgcaggtcggcgatcccgcggaccccgcggtg
cagctcggcccgctgatctccgagcggcagcgggaacgggtcgaggggtacatcgcgaag
ggcaaggcggagggcgcgcgcctggtgctgggcggcggccgccctgagggtctggatcgg
ggctggttcgtcgagccgaccatcttcgccgatgtggacaacaagtcgaccatcgcgcag
gaggagatcttcgggccggtgctgtcggtgatcccctacgagaccgaggacgaggcggtg
gccatcgccaacgactcggtctacggcctggcgggctcggtctggacgaccgacgtcgag
cacggtgccgagattgccgcgcgggtgcgcaccggcacctacgcgatcaattggtatgcg
ttcgaccccagctcaccgttcggcggctacaagaattccggactcggccgcgagaacggc
cccgaagggctcgactcgttctgcgagcagaagtcggtgctcatgccgatggggtggacc
ggctag

DBGET integrated database retrieval system