KEGG   Nocardioides sp. JS614: Noca_0613
Entry
Noca_0613         CDS       T00443                                 

Definition
(GenBank) protein of unknown function DUF1100, hydrolase family protein
  KO
K19188  2,6-dihydroxypseudooxynicotine hydrolase [EC:3.7.1.19]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00760  Nicotinate and nicotinamide metabolism
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
Module
nca_M00810  Nicotine degradation, pyridine pathway, nicotine => 2,6-dihydroxypyridine/succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Noca_0613
Enzymes [BR:nca01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.19  2,6-dihydroxypseudooxynicotine hydrolase
     Noca_0613
SSDB
Motif
Pfam: DUF1100 Peptidase_S9 Hydrolase_4 Abhydrolase_6 AXE1 Abhydrolase_1 BAAT_C DLH PAF-AH_p_II PDR_assoc
Other DBs
NCBI-ProteinID: ABL80147
UniProt: A1SEB2
LinkDB
Position
650063..651214
AA seq 383 aa
MPRIRGTCRRPTAAQSGRCCLPTYGEEMTTETPQVPTAEEEMLNWGRLLMDGLPFADLLA
AQRRDAETSWFDFWMAKADAYEAMGETALKDGNDLTAGYWFWVGSMAAQYAQFLWFDERR
PKGQLRKAGLYHRAAPLLDPPAERVDLPIDDTVIIGYLRRPKGADGPVPCAVLLGGLEST
KEESYMFENLLLERGVATFTFDGPGQGEMFEDVALAGDYHRYTSRVVDYLETLGVTIDED
RIGVLGRSLGGHYALRAASMDDRFRACVTWGGFVQMDDWDFEYPMTKLSWQYVTKSPDLP
TAQERVKEAIDVRPVLAGLKVPTYVMHGAKDETPLTELDLLQEYAVNADITIDLEPEGDH
CCHNLGPAPRLRMADWLANQLRP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgcctcggattcgcggaacatgtagacggccgacggctgcgcagtcgggaagatgctgc
ctcccgacctatggagaagaaatgacgaccgagaccccacaagtcccgacggccgaagaa
gagatgctgaactggggccgcctgttgatggacggtctgccgtttgccgacctcctggcc
gcacagcgtcgggacgctgagacgtcatggttcgacttctggatggcgaaggcggacgcg
tacgaggccatgggtgagaccgccctgaaggacggcaacgacctcacggccggctactgg
ttctgggtcggatcgatggccgcgcagtacgcgcagttcctgtggttcgacgaacgccgc
ccgaagggccagctccgcaaggcagggctctatcaccgcgccgctccactgctcgacccc
ccggctgagcgtgtggacctccctatcgacgacaccgtgatcatcggctacctgcgccgg
cccaagggggccgacgggcccgtcccgtgcgcagtgctgctcggcggcctcgagagcacg
aaggaggagagctacatgttcgagaacctcctactcgagcgaggcgtcgccaccttcacg
ttcgacggtcccggccagggtgagatgttcgaggacgtcgcactcgccggcgactaccac
cgctacacctcacgggtggtcgactacctcgagaccctaggggtcactatcgacgaggat
cggatcggagtgctgggccgcagcctgggaggacattatgcgctgcgtgccgcctcaatg
gacgaccgcttccgtgcatgcgtcacctggggtggtttcgtccagatggacgactgggat
ttcgagtaccccatgaccaagctcagctggcagtacgtaacgaagtcgcccgatctgccc
actgcgcaggagcgggtgaaggaagccatcgacgtacgccccgtgctggctggactgaag
gtacccacgtacgtgatgcacggggccaaggacgagactcctctcaccgagctggatctg
ttgcaggagtacgcggtcaacgcggacatcacgattgatctcgagcccgagggcgatcac
tgctgccacaacctcggtcccgccccgcgccttcgcatggcggactggctggcgaaccag
cttcgcccctga

DBGET integrated database retrieval system