KEGG   Nocardioides sp. JS614: Noca_0907Help
Entry
Noca_0907         CDS       T00443                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ABL80430
UniProt: A1SF45
LinkDB All DBs
Position
complement(948797..949897)
Genome map
AA seq 366 aa AA seqDB search
MQLPVMPPVQPMLAKSVKGIPDPEKHGGLSFEPKWDGFRCLVFKDGDEVELASRNTKPLT
RYFPEVVAAMREQLPHRCVLDGELFVALPNDAGVERLEFEVLQERIHPARSRIELLAEKT
PASYVAFDLLALDDESYAERPFAERRAALERALGDLDGPCFLTRTTTDPAQAEEWFHQFE
GAGLDGVVAKPLGAAYQQNARTMLKIKHERTADVVVAGYREHKTSTPDRPLLGSLLLGLY
ADGQLQHVGVSASFTAARRAELIEELQPLVVPIADHPWGEWADWAIANPDRVPGTQSRWS
QGKDLSFTPLRPERVLEVAYDHMEGRRFRHTAQFRRWRPDRDPESCGYDQLEEPVGYDLA
RILNVD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgccggtgatgccgcccgtccagccgatgctcgcgaagtcggtcaaggggatc
cccgaccccgagaagcacgggggcctgagcttcgagccgaagtgggacgggttccggtgc
ctcgtgttcaaggacggcgacgaggtggagctggccagccgcaacaccaagccgctgacc
cgctacttccccgaggtcgtcgccgcgatgcgcgagcagctgccgcaccgctgcgtgctg
gacggcgagctcttcgtcgcgctcccgaacgacgcgggggtggagcgcctggagttcgag
gtgctccaggagcggatccacccggcccggtcccgcatcgagctgctggccgagaagacg
ccggcctcgtacgtcgcgttcgacctgctcgcgctcgacgacgagtcgtacgccgagcgg
ccgttcgcggagcgtcgcgccgccctcgagcgggcgctgggcgacctcgacgggccctgc
ttcctcacccgcaccaccacggatccggcgcaggccgaggagtggttccaccagttcgag
ggcgccggcctcgacggcgtggtcgccaagcccctgggggcggcgtaccagcagaacgcc
cgcaccatgctcaagatcaagcacgagcgcaccgccgacgtggtcgtcgccggctaccgc
gagcacaagaccagcacccccgacaggccgttgctcggcagcctgctgctcgggctgtac
gccgacggccagctccagcacgtcggtgtgagcgccagcttcaccgccgcccgtcgcgcc
gagctgatcgaggagctgcagccgctcgtcgtgccgatcgcggaccacccctggggcgag
tgggccgactgggcgatcgccaacccggaccgggtgccgggcacccagagccggtggagc
cagggcaaggacctctcgttcaccccgctgcgccccgagcgggtgctggaggtcgcctac
gaccacatggagggacgccggttccgccacaccgcccagttccggcgctggcggcccgac
cgcgacccggagtcgtgcgggtacgaccaactggaggagccggtgggctacgacctcgct
aggatcctgaacgtcgactga

DBGET integrated database retrieval system