KEGG   Nocardioides sp. JS614: Noca_1166Help
Entry
Noca_1166         CDS       T00443                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ApbA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABL80681
UniProt: A1SFU6
LinkDB All DBs
Position
1238590..1239645
Genome map
AA seq 351 aa AA seqDB search
MTQIMQALVVREPNVLEIAEVPVPEPGRNEVLARVRSVSICGTDAHLINGDYPGFWPPQF
PFTPGHEWAGDVVALGEGADTFGWRVGDRVAGTSHSACGACQKCVEGQYNLCENYGRPAL
HAQYGHNAQGVNATYAVHNVKSIFRLPDEVSFDVGALADPASIALHVARRGNIKPGDTVA
VTGAGAIGLLAADAALIDGAARVIVVGRGHRLERAAALGFETVDTRTGDPVAEVRGLTSG
LGADVVLECAGVPETLIWGMAMLRRGGRCAMVGIPTEDVSLKCQPLVLDELELVGSRASA
GEMRRVLPFIANGRMRAEELITHHFPLSEYDKALATFNDRASGAIKIIVNP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatcatgcaggccctggtggtgcgcgagcccaatgtgctcgagatcgccgag
gtgcctgtgcccgagcccggtcgcaacgaggtcttggcgcgagtccgatccgtctcgatc
tgcggcaccgacgcccacctcatcaacggtgactaccccgggttctggccgccgcagttc
cccttcacccccggccacgaatgggcgggtgacgtcgtggccctcggtgagggtgcggac
accttcggctggcgggtcggcgaccgggtcgcgggcacgagccacagtgcttgcggcgcc
tgccagaagtgcgtcgaaggccagtacaacctgtgtgagaactacggcaggccggcgctc
catgctcagtacggacacaacgcgcagggggtcaacgccacctatgccgtccacaacgtc
aagtcgatcttccggctgcccgatgaggtgagcttcgatgtcggtgccctggctgacccg
gccagcatcgccctgcacgtagcacgtcgcggcaacatcaagccgggggacaccgttgcg
gtgaccggtgccggcgcgatcggcctcctcgcggctgacgccgcactgatcgatggggcc
gcgcgggtgatcgtggtggggcgcggccaccgtctggagcgggctgctgcgctggggttc
gagaccgtcgacacgcgcacaggcgacccggtcgccgaggtgcgtggactgacgagtggc
ctcggcgccgacgtggtcctggaatgtgcgggcgtccccgagaccctgatctgggggatg
gcgatgctgcgccgcggcggtcgctgcgcgatggtcggcatcccgaccgaggacgtcagc
ctgaagtgccagcccctcgtgctcgatgagctggagctggtcggctcacgcgcctctgcc
ggtgagatgcgccgcgtcctgcccttcatcgccaacgggaggatgcgggccgaggagctc
atcacccaccacttcccgctctcggagtacgacaaggcgctggccacgttcaacgaccgt
gccagcggtgcgatcaagatcatcgtcaacccctag

DBGET integrated database retrieval system