KEGG   Nocardioides sp. JS614: Noca_1235Help
Entry
Noca_1235         CDS       T00443                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nca  Nocardioides sp. JS614
Pathway
nca03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Noca_1235
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nca03400]
    Noca_1235
Enzymes [BR:nca01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Noca_1235
DNA repair and recombination proteins [BR:nca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Noca_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ABL80749
UniProt: A1SG14
LinkDB All DBs
Position
1311569..1312504
Genome map
AA seq 311 aa AA seqDB search
MESMRPMLATHGRQVPTGEAWAHEVKWDGVRALTEVRDGALRMTSRNENAITIAWPELAT
SPLGDRDLLVDGEIIALNERGLPDFRTLQDRMHVRKAATAARLSREVPATYMVFDVLRID
GRDLTGEPLDVRRELLAGLGLDGTWQVPGSYDDGPMLFEATLQQGFEGIVSKRRSSRYAF
GERSPHWLKFAHRHRVSYVVGGWRPQEGTADRLASLLVGEPTADGLLYRGRVGSGIGPKQ
GRALAELVARLGRPASPFADEVPRADAQGTRWLEPVLVVDIDTHGRGYQRLRQPSFQGVR
SDLTPEDLCST
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatgcgcccgatgctcgccacccatggtcggcaggtcccgacgggggaggcc
tgggcgcacgaggtgaagtgggacggggtccgcgcgctgaccgaggtgcgcgacggcgcg
ctgcggatgaccagccgcaacgagaacgcgatcacgatcgcctggcccgagctcgcgacc
agcccgctgggtgatcgcgacctgctcgtggatggcgagatcatcgcgctcaacgagcgc
gggctgccggacttccgcaccctccaggaccggatgcacgtgcgcaaggcggccacggcg
gcccggctctcgcgggaggtgcccgcgacctacatggtcttcgacgtgctccggatcgac
ggtcgcgacctgaccggcgagccgctcgacgtacgccgggagctgctcgccggcctcggc
ctggacggcacctggcaggtgccgggctcctacgacgacgggccgatgctgttcgaggcc
accctccagcagggcttcgagggcatcgtcagcaagcgccgcagctcccgctacgccttc
ggcgagcgttcgccgcactggctgaagttcgcgcaccggcaccgggtctcctacgtggtg
ggcgggtggcgcccccaggagggcaccgccgaccggctcgcctcgctgctcgtgggggag
ccgaccgccgacgggctgctctaccgtggccgggtgggcagcgggatcgggccgaagcag
gggcgtgcgctggccgagctggtggcccggctcggccgccccgccagcccgttcgccgac
gaggtgccgcgcgccgacgcgcagggcacccgctggctggagccggtcctggtcgtggac
atcgacacccacggtcgtgggtaccagcgcctgcgccagccctcgttccagggggttcgc
tccgacctcaccccggaggacctgtgctccacctga

DBGET integrated database retrieval system