KEGG   Nocardioides sp. JS614: Noca_1725Help
Entry
Noca_1725         CDS       T00443                                 

Definition
(GenBank) Superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Noca_1725
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Noca_1725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: ABL81238
UniProt: A1SHF3
LinkDB All DBs
Position
complement(1834591..1834992)
Genome map
AA seq 133 aa AA seqDB search
MFVRLFAPTLEVSAHCDLPCGVYDPAQARIEAESIKAIIAKVADNDDPDFRTRAILIKEQ
RSELVKHHLWVLWTDYFKPPHFEKYPQLHTLVNEATKLAGAAGTKGELDAGKADELLAKI
DQIAEIFWETKKA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgcgactgttcgcccccaccctcgaggtttccgcccactgcgatcttccctgc
ggcgtgtacgaccccgcgcaggcgcgcatcgaggcggagtccatcaaggccatcatcgcc
aaggtcgccgacaacgacgacccggacttccgcacccgagcgatcctcatcaaggagcag
cgctccgagctggtcaagcaccacctctgggtgctgtggaccgactacttcaagccgccg
cacttcgagaagtacccccagctgcacacgctcgtgaacgaggccaccaagctggccggc
gccgccggcacgaagggtgagctcgacgccggcaaggccgacgagctgctcgcgaagatc
gaccagatcgccgagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system