KEGG   Nocardioides sp. JS614: Noca_1978Help
Entry
Noca_1978         CDS       T00443                                 

Definition
(GenBank) protein kinase
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo RIO1 Pkinase_fungal DUF4307 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ABL81488
UniProt: A1SI53
LinkDB All DBs
Position
complement(2109017..2110465)
Genome map
AA seq 482 aa AA seqDB search
MIAGRYTLEREVGRGGMGAVWLGRDEVLGRQVALKRVGLAPGVTTPDLARAEREARLAAR
LNHPHVVAVYDLVIEGPDNTEQWLVMEYVEGSTLAELLRRDGAMTPDRAAAFLGQAADAL
AAAHAAGIVHRDVKPSNILVAPDGQVKLSDFGIARAEADASLTQTGLVTGSPAYLSPEVA
SGQQATDASDVWSLGATLFHALAGHPPYEVGDNLLGALYRIVHEDPPRLPEAGWLAPLLL
ATMCREPADRWSMARVRDVLVAGPSTPVLAGVPAAAPAPAADPSPTRVLSRELPPVPPAY
PPAPAAPPPATPSPGGRRRDRSGMLPVLAAVAAVVAIAVIGWLAYTAGTDGQRDGTAATP
GTGQGSSGGSQSPSGTGAPAGVTADGLESFIEDYLATVTADPKSAWGLLTPDFQAASGGF
GQYNSFWKSIETADVLSAQPDPAHRRISYTVEYLRRDGSKATDDVTLLLEGTDGDYLIAA
EP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctggcaggtacacgctcgagcgcgaggtgggtcgcggcggcatgggcgccgtc
tggctcggccgggacgaggtgctcgggcgccaggtcgcgctgaagcgggtcggcctggcc
cccggggtcaccacccccgacctggcccgcgccgagcgcgaggcccggctcgccgcgcgc
ctcaaccacccgcacgtggtcgcggtctacgacctggtcatcgagggccccgacaacacc
gagcagtggctggtgatggagtacgtcgagggctcgaccctcgccgagctgctccggcgc
gacggcgcgatgaccccggaccgggcggccgccttcctcgggcaggccgcggacgcgctc
gccgccgcccacgcggccggcatcgtgcaccgcgacgtgaaaccctccaacatcctggtc
gcgccggacgggcaggtgaagctctcggacttcgggatcgcccgtgcggaggcggacgcc
tcgctgacccagaccgggctggtgacgggctcccccgcctacctctcccccgaggtcgcc
tcgggtcagcaggcgacggacgccagcgacgtctggtcgctgggggccacgctcttccac
gcgctggccggccacccgccgtacgaggtcggagacaacctgctgggcgcgctctaccgg
atcgtgcacgaggacccgccgcggctgcccgaggccggctggctcgccccgctcctcctg
gcgacgatgtgccgcgagccggccgatcgctggtcgatggcccgggtgcgggacgtgctc
gtcgccggtccctcgacgccggtcctcgctggcgtgccggcggccgcgccggcaccggcg
gccgacccgagtccgacccgggtgctgtcgcgggagctgccgccggtcccgccggcgtac
ccccctgctccggcggcgcctccgccggcgacgccgtcgcccggcgggcgccgacgtgat
cgcagcggcatgctgccggtgctcgcggcggtggccgccgtcgtcgcgatcgcggtcatc
gggtggctggcctacacggcggggaccgacggccagcgcgacggcaccgcggcgacaccg
ggcaccggacagggcagcagcggagggtcgcagagcccgtccgggaccggcgcgcccgcc
ggggtcaccgccgacgggttggagagcttcatcgaggactacctggcgacggtgacggcc
gaccccaagtccgcctggggtctgctgacgccggacttccaggccgccagcggcgggttc
ggccagtacaactcgttctggaagagcatcgagaccgccgacgttctctcggcccagccg
gacccggcccaccggcggatcagctacaccgtggaatacctccgccgcgacggctcgaag
gccaccgacgacgtgaccctgctgctcgagggcaccgacggcgactacctcatcgctgcc
gagccgtga

DBGET integrated database retrieval system