KEGG   Nocardioides sp. JS614: Noca_2271Help
Entry
Noca_2271         CDS       T00443                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ABL81776
UniProt: A1SIZ1
LinkDB All DBs
Position
2421762..2422718
Genome map
AA seq 318 aa AA seqDB search
MPTTWEPMLAKPAATLPAVGGLLGGTVYEPKWDGYRAILERTGAGCRVWSRKGADLAAGF
PEIVQAALERLEPGTVIDGELVVWRDGRLDFGALAPRLAYRGRRRSPADLPPASFLAFDV
LVAGDVDLRTKPLRDRRAVLEQLAGSWQPPMQLTPQTADPAEAQRWLTEYDAADVGVEGL
VAKGAGQRYLPGQRGWVKFRIRNTREATVGAVIGRVDQPVRLILGLRDAAGTLRVAGATH
PLTPRESVELASVLVGTDDHPWPAELGTRQLGRFSREPVAITRVIPTVIVEVEADTAFEH
GRWRHLTRYRRLRLDRSS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaccacctgggagccgatgctggccaagccggcagccacgctgccagcggtcggc
ggcctgctgggcggcaccgtctacgaaccgaagtgggatggctaccgggccatcctcgag
cgcacgggcgcagggtgccgggtgtggtcacgcaagggcgccgacctagcggcagggttc
cccgagatcgtccaagccgccctcgagcggctggagccgggcacggtgatcgacggtgaa
ctcgtcgtgtggcgggacggccgactcgacttcggggcactggccccgcggctggcatac
cgcggccgccgcaggtcgccggcggacctcccacctgcctccttcctagctttcgacgtc
ttggttgcaggcgacgtcgacctgcggaccaagccgctgcgcgatcgccgggcagtgctc
gagcagttggcgggatcgtggcagccgccgatgcagctgacgccgcagaccgcggacccg
gcggaggcgcagcgctggctgacggagtacgacgcggcggacgtcggtgtggagggcctg
gtcgccaagggagccggtcagcgctacctgcctggtcagcgggggtgggtgaagttccgt
atccgcaacactcgcgaggccacggtcggggcggtcatcggtcgtgtcgaccaaccggtt
cggctgatcctcggcctccgagacgccgctggcacgttgcgtgtggccggcgcgacccat
ccgctcactccgagggagtcggtcgagctcgcctcggtgctcgtcggcaccgatgaccac
ccgtggccggctgaactcggcacccgtcagctggggcgtttcagccgcgagccggttgcg
atcacccgggtgatccccacggtgatcgtcgaggttgaggcagacaccgcgtttgagcac
ggccggtggcggcacctgacccgttaccgccggctgcgcctggaccgctccagctga

DBGET integrated database retrieval system