KEGG   Nocardioides sp. JS614: Noca_3093Help
Entry
Noca_3093         CDS       T00443                                 

Definition
(GenBank) hypothetical protein
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nudix_N_2 zinc_ribbon_2 F5_F8_type_C zf-ribbon_3 DZR
Motif
Other DBs
NCBI-ProteinID: ABL82595
UniProt: A1SLB0
LinkDB All DBs
Position
3295366..3296232
Genome map
AA seq 288 aa AA seqDB search
MRFCVSCGHELGVGRFCTNCGHPIGQPIDQGWRTDTAERPAVAVPPAPRYPLFADEAVEP
SAAAHRRPGPPWGLWAAAALALVVVAGLGVWLLTGDDSGPDARRPTSSQPPASSGPASPP
SQDEPGHDPARVTAEASVEVPDTAPPGQDVSGNRVDYAGENLLDGIPETTWRMPGDGTGE
ELVITLAAETRLRSVGLVNGYAKTARDAEGRELDWYHGNRRVTSVEWVFDDGTTITQDLD
DTTAVQSVDVDVTTTTVTLRLVAVSAPGQGRAARDYTAISDVSLVGAS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctgcgtcagctgcggccacgagctgggggtcggccgcttctgcacgaactgc
ggccaccccatcggccagcccatcgaccagggctggcgcaccgacaccgccgagcgaccc
gcggtcgcggtgcctcctgcgccgcggtacccgctgttcgccgacgaggccgtggagccg
tcggccgccgcacaccgccggcccggcccgccctggggactgtgggccgccgcggccctg
gccctggtcgtcgtcgccggactcggcgtctggctgctcaccggcgacgactccggcccc
gacgcccgacgccccacgagctcgcagccgccggcatcctcgggcccggcctcgcccccg
tcgcaggacgagcccggccacgacccggcccgggtcaccgccgaggcgagcgtcgaggtg
ccggacaccgccccgcccggccaggacgtgtccggcaaccgggtcgactacgcgggcgag
aacctcctcgacgggatcccggagaccacctggcggatgcccggtgacggcaccggtgag
gagctggtcatcaccctggccgccgagacccggctgcgcagcgtggggctggtcaacggg
tacgcgaagaccgcccgggacgccgagggacgcgagctcgactggtaccacggcaaccgc
cgggtcaccagcgtggagtgggtcttcgacgacggcaccacgatcacccaggacctcgac
gacacgaccgcggtccagtccgtcgacgtcgatgtcaccaccacgaccgtcacgctccgg
ctggtcgccgtctcggcgccgggccagggccgggcggcccgcgactacaccgcgatcagc
gacgtgtcgctggtaggtgcgtcctag

DBGET integrated database retrieval system