KEGG   Nocardioides sp. JS614: Noca_3575Help
Entry
Noca_3575         CDS       T00443                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00020  Citrate cycle (TCA cycle)
nca00480  Glutathione metabolism
nca01100  Metabolic pathways
nca01110  Biosynthesis of secondary metabolites
nca01120  Microbial metabolism in diverse environments
nca01130  Biosynthesis of antibiotics
nca01200  Carbon metabolism
nca01210  2-Oxocarboxylic acid metabolism
nca01230  Biosynthesis of amino acids
Module
nca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nca_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noca_3575
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Noca_3575
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Noca_3575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ABL83075
UniProt: A1SMP0
LinkDB All DBs
Position
complement(3792669..3794882)
Genome map
AA seq 737 aa AA seqDB search
MATIIYTHTDEAPLLATYSFLPIIQAYAAKAGVEVETRDISLAGRIIAQFPDRLTAEQRI
DDALAELGELAKRPEANIIKLPNVSASVPQLKTAIKELQEQGYDLPDYPENPQTDEDRDV
RARYDKVKGSAVNPVLRQGNSDRRAPASVKQYAKAYPHRMGAWSTDSKTNVATMGEHDFK
TNEKSVVLAADDTLRIELEAADGTTTVLKESLPVLAGEVVDATTLQVAHLHGFLRNAIAR
AKSEGVLFSVHLKATMMKVSDPIIFGHVVRAFFEPVFAKYGDDLAAAGLSPNDGLGAILG
GLDKLSNGAEIKAAFEQAIADGPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGHMW
GPDGQEADTLAVIPDSSYAGVYQTVIDDCREHGAFDPATMGSVPNVGLMAQAAEEYGSHD
KTFEIPTDGTVRVLDSSGAVLIEHDVAAGDIWRACQTKDAPIRDWVKLAVTRARATGAPA
VFWLDETRAHDASLITKVNAYLPEHDTEGLDIKILAPELATAYSLERIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLLKENYLRWDSL
GEFFALAASFEHLSGYAANPGAQVLADTLDRATGTFLDRDKSPTRKLGGIDNRGSHFYLA
LYWAQELAAQTEDADLAAAFKPLAETLAAQEQQIVEELLAVQGSPADIGGYYRPDDALAS
AVMRPSATLNEALASLG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggccacgatcatctacacccacaccgacgaggcgccgctgctcgcgacgtactcgttc
ctgccgatcatccaggcgtacgccgcgaaggccggtgtggaggtggagacccgcgacatc
tccctcgcgggccggatcatcgcccagttccccgaccgcctgaccgccgagcagcggatc
gacgacgcgctggccgagctcggcgagctggccaagcggcccgaggccaacatcatcaag
ctgccgaacgtctccgcctccgtcccgcagctcaagaccgcgatcaaggagctccaggag
cagggctacgacctgcccgactaccccgagaacccgcagaccgacgaggaccgggacgtc
cgggcgcgctacgacaaggtcaagggctcggcggtcaacccggtgctgcggcagggcaac
tccgaccgccgtgcgcccgcgtcggtcaagcagtacgcgaaggcctacccgcatcggatg
ggcgcgtggagcaccgactccaagaccaacgtcgccaccatgggcgagcacgacttcaag
accaacgagaagtccgtggtgctcgccgccgacgacaccctgcgcatcgagctcgaggcc
gcggacggcaccacgaccgtgctcaaggagtcactgccggtcctggccggtgaggtcgtg
gacgccacgaccctccaggtcgcccacctgcacggcttcctgcgcaacgcgatcgcccgc
gcgaagagcgagggcgtgctgttcagcgtccacctcaaggcgacgatgatgaaggtctcc
gacccgatcatcttcggccatgtggtgcgggccttcttcgagccggtcttcgcgaagtac
ggcgacgacctcgccgcggccggcctcagtccgaacgacggcctcggcgccatcctcggc
gggctggacaagctctcgaacggcgccgagatcaaggcggccttcgagcaggcgatcgcc
gacggccccgcgctcgcgatggtcgactccgaccgcggtatcaccaacctgcacgtgccc
tccgacgtgatcgtggacgcctcgatgccggcgatgatccgcacctccggccacatgtgg
ggccccgacggccaggaggccgacaccctggccgtgatcccggactcctcctacgccggg
gtctaccagacggtgatcgacgactgccgcgagcacggcgcgttcgacccggcgacgatg
ggctcggtgccgaacgtcggcctgatggcccaggcggccgaggagtacggctcccacgac
aagaccttcgagatccccaccgacggcaccgtgcgggtcctcgactcctcgggcgcggtc
ctcatcgagcacgacgtcgcggccggcgacatctggcgcgcctgccagaccaaggacgcg
ccgatccgcgactgggtcaagctcgccgtgacccgcgcccgcgcgaccggtgcgccggcg
gtcttctggctagacgagacccgcgcccacgacgccagcctgatcacgaaggtcaacgcc
tacctgcccgagcacgacaccgagggcctggacatcaagatcctggcgcccgagctggcg
acggcgtactccctcgagcggatccgccgtggcgaggacaccatctcggtgaccggcaac
gtgctgcgcgactacaacaccgacctgttcccgatcctcgagctcggcacctccgcgaag
atgctctcggtcgtgccgctgatggccggcggcgggctgttcgagaccggcgccgggggc
tcggcgcccaagcacgtccagcagctgctcaaggagaactacctgcgctgggacagcctc
ggtgagttcttcgcgctcgcggcgtccttcgagcacctctccgggtacgccgccaacccg
ggagcccaggtcctcgccgacaccctggaccgcgcgacgggcactttcctggaccgggac
aagtcgccgacccgcaagctgggcggcatcgacaaccgcggctcgcacttctacctggcg
ctgtattgggcgcaggagctggcggcccagaccgaggacgccgacctcgcggccgcgttc
aagccgctggccgagacgctcgccgcgcaggagcagcagatcgtcgaggagctgctcgcc
gtgcagggctctccggccgacatcggcggctactaccggcccgacgacgccttggcgtcc
gcggtgatgcggccctcggcgaccctgaacgaggcgctggcctcccttggctga

DBGET integrated database retrieval system