KEGG   Nocardioides sp. JS614: Noca_3634Help
Entry
Noca_3634         CDS       T00443                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
nca  Nocardioides sp. JS614
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABL83134
UniProt: A1SMU9
LinkDB All DBs
Position
complement(3854528..3855970)
Genome map
AA seq 480 aa AA seqDB search
MTLDRSAFFIDGGWAAPATSATLQVVSPHTEQVVATVPEGSAADIDAAVAAARRAFDDGP
WPRMSPQERIEVVQAFSNLYAGKLAEMAELITIEMGSPTSFANLAQSPAPWMQIESFLAV
ARAFPWEEARPGALGADVIVRREPVGVVAAIPPWNVPQFTTMSKVVPALLAGCTVVVKPA
PETPLDTYLMAELLAEAGVPAGVVNIVAAGREVGEHLVAHPGVDKVAFTGSTAAGRKIAA
VCGEQLKRVSLELGGKSAAIVLDDADLAATMEGLKFTALMNSGQACVAQTRILASRSRYD
EVVDALAATVSGMQVGDPMDPATEIGPLVAQRQQERVEKYIALGQEEGARVVVGGNGRPD
GLDAGWYVRPTVFADVDNRMRIAREEIFGPVLSVIPFDDVDDAVRIANDSDYGLAGTVWT
GDVEAGLDVARRVRTGTYGVNTYTMDFAAPFGGYKSSGIGREFGPEGLAQYTELKAIYTP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgaccgctccgcgttcttcatcgacggcggctgggcggcgccggcgacctcg
gccacgctccaagtcgtctcgccgcacaccgagcaggtggtcgcgaccgtgcccgagggc
agcgccgccgacatcgacgccgcggtcgcggcggcgcgtcgggcgttcgacgacggcccc
tggccgcggatgagcccacaggagcggatcgaggtcgtccaggcgttctcgaacctctac
gccggcaagctcgccgagatggccgagctgatcacgatcgagatgggctcgccgacgtcg
ttcgccaacctcgcccagtccccggcgccgtggatgcagatcgagtcgttcctcgcggtc
gcgcgggcgttcccgtgggaggaggcgcggcccggcgcgctcggcgccgacgtgatcgtg
cggcgcgagccggtcggcgtggtcgcggcgatcccgccgtggaacgtcccgcagttcacg
acgatgtccaaggtcgtcccggcgctgctcgccggctgcacggtggtggtcaagccggcg
cccgagaccccgctggacacctacctgatggccgagctgctcgcggaggccggcgtaccg
gccggcgtcgtcaacatcgtggccgcgggccgcgaggtcggcgagcacctggtcgcccac
ccgggcgtcgacaaggtcgccttcaccggctccactgcggcgggccgcaagatcgcggcc
gtctgtggcgagcagctcaagcgggtctcgctcgagctcggcggcaagtccgcggcgatc
gtgctcgacgacgccgacctggccgccacgatggagggcctgaagttcaccgcgctgatg
aactccgggcaggcctgcgtcgcgcagacccggatcctcgcctcccggagccggtacgac
gaggtggtggacgcgctggccgcgaccgtgtccgggatgcaggtgggcgacccgatggac
ccggccaccgagatcggcccactggtggcccagcgccagcaggagcgggtcgagaagtac
atcgccctcggtcaggaggagggcgcgcgcgtggtcgtcggcggcaacggccgccctgac
gggctggacgcgggctggtacgtccgccccacggtgttcgccgacgtcgacaaccggatg
cggatcgcccgggaggagatcttcggcccggtgctctcggtgatccccttcgacgacgtg
gacgacgcggtccggatcgccaacgactccgactacggcctcgccggcacggtgtggacc
ggtgacgtcgaggccggcctcgacgtggcccggcgggtgcgcaccggcacctacggcgtg
aacacctacacgatggacttcgcggcgccgttcggcggctacaagtcctccgggatcggc
cgcgagttcggcccggagggcctggcccagtacaccgagctgaaggcgatctacacgccc
tga

DBGET integrated database retrieval system