KEGG   Niveispirillum cyanobacteriorum: C0V82_01470Help
Entry
C0V82_01470       CDS       T05262                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ncb  Niveispirillum cyanobacteriorum
Pathway
ncb00564  Glycerophospholipid metabolism
ncb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C0V82_01470
Enzymes [BR:ncb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C0V82_01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like GIDA NAD_binding_8 FAD_binding_3 Pyr_redox_3 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AUN31582
UniProt: A0A2K9NEZ2
LinkDB All DBs
Position
eg_1:complement(325288..326853)
Genome map
AA seq 521 aa AA seqDB search
MGLNRASGIAALAAGGVWDLVIIGGGATGLGTALDAAARGYRTLLLEGHDFAKGTSSRAT
KLVHGGVRYLAQGNIPLVRHALHERGRLLANAPQVTRRQGFVVPCYRWWDMAFYGAGLFA
YDLLAGKLGLGRSRLLSRAEVMRRLPTVKTEGLVGGIHYYDGQFDDSRLAITIAASAADH
GATLLNYVRVTGLLKEDGRIAGITARDMETGSDYRIQAKAVVNAAGIFMDDIRHMDRPDL
AEGLSLSQGIHLVLDPGFLASDDAILIPKTDDGRVLFVLPWLGRTVIGTTDTPIPTASME
PRAQEAEIQFLLDHAAHYLTRAPARSDVLSVFTGIRPLVKVKGASGTSAVPRDHVLMVSD
SGLVTITGGKWTTYREMAEQTVDAALRVGGFTPTPSPTRELRLHGWTPRDGIDGTDPLAA
YGADAPKVRAVLAEQPGWTAPMHPDLPYALGEAAYAARHLMARTVEDVLSRRTRALLLNA
QAAVAAAPAVAQLLATELGRDAKWIDAQVAEFTKLAGIYRV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggattgaaccgggcaagcgggatcgctgccctggccgctggtggtgtctgggatctg
gtgatcatcggcggcggggccacgggcctgggcacggcgctggacgcggcggcgcgcgga
tatcgcacgcttctcctggaagggcatgatttcgccaagggcacctcgtcgcgcgccacc
aagctggtgcatggcggggtgcgctatctggcgcagggcaatatccccctggtccgccac
gccctgcatgaacgcgggcggctgctggccaatgcgccgcaggtgacgcggcggcaaggg
ttcgtagtgccctgctatcgctggtgggacatggcgttctatggcgcgggcctgttcgcc
tatgacctgctggccggcaagctgggactgggccgctcgcgcctgctgtcgcgggccgag
gtgatgcggcggctgccgacggtcaagacagagggtctggtgggcggcatccattattat
gatgggcagtttgatgacagccgcctggccatcaccatcgcggccagtgccgccgaccat
ggcgccaccctgctgaactatgtccgcgtcacgggtctgctgaaagaagatggccgcatc
gcgggtatcacggcccgcgacatggagaccggcagcgattaccgcatccaggcgaaagcg
gtggtgaatgccgccgggattttcatggatgatatccggcatatggaccggcccgatctg
gccgagggtctgtcgctgagccagggtatccatctggtgctggaccccggtttcctggcc
agcgatgacgccatcctgatccccaaaaccgatgatggccgcgtgctgttcgtgctgccc
tggttgggccggacggtgatcggcaccaccgacacgccgatcccgacggccagcatggaa
ccgcgcgcgcaggaggcggaaatccagttcctgttggaccatgctgcccattacctgacc
cgcgcgccggcccgatcggatgtgctgtcggtctttaccggcatccgcccgctggtgaag
gtgaagggtgcctcgggcacgtcggcggtaccgcgcgatcatgtgctgatggtatcagac
agcggccttgtcaccatcacgggcggcaaatggaccacctatcgcgagatggcggaacag
acggtcgatgcagccctgcgtgtaggcggttttacgccgacgcccagcccgaccagggag
ttgcgcctgcatggctggaccccgcgcgatggcatcgacggcaccgacccgttggccgcc
tatggcgctgatgcgcccaaggtgcgagctgttctggccgaacagccgggatggacagcg
ccgatgcatcccgacctgccctatgccctgggtgaagccgcatacgccgcccgtcacctg
atggcgcgtacggtcgaagatgtcctgtcgcggcgcacccgcgctcttctactgaacgcc
caagccgccgtcgccgccgcccccgcagtcgcacagctgttggccaccgaactgggccgc
gacgccaaatggattgacgcgcaggtcgcagaatttacgaagctggcgggcatttatcgg
gtgtag

DBGET integrated database retrieval system