KEGG   Niveispirillum cyanobacteriorum: C0V82_07530Help
Entry
C0V82_07530       CDS       T05262                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ncb  Niveispirillum cyanobacteriorum
Pathway
ncb00473  D-Alanine metabolism
ncb00550  Peptidoglycan biosynthesis
ncb01100  Metabolic pathways
ncb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ncb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C0V82_07530
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C0V82_07530
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C0V82_07530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ncb01011]
    C0V82_07530
Enzymes [BR:ncb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C0V82_07530
Peptidoglycan biosynthesis and degradation proteins [BR:ncb01011]
 Precursor biosynthesis
  Amino acid ligase
   C0V82_07530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: AUN30098
UniProt: A0A2K9NAF2
LinkDB All DBs
Position
eg_1:1663615..1664550
Genome map
AA seq 311 aa AA seqDB search
MGTENRSKHVAVLLGGWSAEREVSLVSGSRIAEALESKGYKVTAIDVQRDLAGLVAALTP
HPDVIFNALHGKGGEDGLIQGVLEYLGVPYTHSGVMASAVAMDKALTKRILATVGMPVAD
GVIATKEQVLAGHVLPPPYVVKPVDEGSSVGVRIVRESDNFTVLEEDSWVYGRRVLVEKF
IPGRELTVGVMGDRALAVTEIVPRTAFYDYEAKYADGGSVHVCPAQIPADVAEEAKRLAL
LAHQVLGCSGVSRTDFRWDDSKAGISGLCFLETNTQPGFTPTSLLPEQAASLGISYADLC
AWIVEHARCHA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgagaaccgttcgaagcatgtcgccgtcctgttgggcggatggtctgcggag
cgggaagtgtccctggtcagcgggtcccgcatcgccgaggccctggagagcaagggctac
aaggtcacggccattgatgtgcagcgtgatctggccggtctggtcgccgccctcaccccg
catcccgacgtgattttcaacgccctgcatggcaagggcggcgaggatgggttgatccag
ggcgttctggaatatctgggcgtgccctatacccattctggcgtgatggcatccgccgtc
gccatggacaaggccctgaccaagcgcatcctggcgaccgtgggcatgccggtggccgat
ggcgtgatcgccaccaaggaacaggtcctggccggccatgtcctgcccccgccctatgtc
gtgaagcccgtggacgagggttccagcgtcggtgtgcgcatcgtgcgcgagagcgacaat
ttcacggtgctggaagaagatagctgggtctatggccgccgcgtgctggtggagaagttc
attccgggtcgtgagctgaccgtcggtgtcatgggcgaccgcgccctggccgtgacggaa
atcgtgccgcgcaccgccttttatgattatgaggcgaagtacgccgatggtggttcggtg
catgtctgcccggcccagattccggcggatgtggccgaggaagcaaagcgtctggcgctg
ctggcgcatcaggttctgggctgttcgggcgtgtcgcgcaccgatttccgctgggatgac
agcaaggccggcatcagcggcctgtgcttcctggaaaccaatacccagcccggcttcacg
ccgacctccctgctgcccgaacaggcggcatcgctgggcatcagctacgcagatctgtgc
gcctggatagtggagcatgcccgatgccacgcgtaa

DBGET integrated database retrieval system