KEGG   Niveispirillum cyanobacteriorum: C0V82_09325Help
Entry
C0V82_09325       CDS       T05262                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ncb  Niveispirillum cyanobacteriorum
Brite
KEGG Orthology (KO) [BR:ncb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ncb01002]
    C0V82_09325
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncb04147]
    C0V82_09325
   04090 CD molecules [BR:ncb04090]
    C0V82_09325
Enzymes [BR:ncb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     C0V82_09325
Peptidases [BR:ncb01002]
 Metallo Peptidases
  Family M2
   C0V82_09325
Exosome [BR:ncb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C0V82_09325
CD molecules [BR:ncb04090]
 Proteins
  C0V82_09325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AUN31780
UniProt: A0A2K9NF83
LinkDB All DBs
Position
eg_1:2036342..2038177
Genome map
AA seq 611 aa AA seqDB search
MRITKHLRAGVALSAMIILAACGQPGDKQTAAPAKPTVEEATAFITKAEAELGAAREKAS
RTAWVQNTYITPDTLALAADSNASYSALVSRLTAESKRFVGLELPADVARKLNLLRMETA
LPSPADPALNKELAELDAKLGELYATGKVCRDDGSDCLTLDEIDDVFRTSRDEKELKRLW
AGWHKVGQEMKPLYQREVEIANIGAKELGLPDAGTLWRSGYDMPPEAFEQEADRLWGQVK
PLYTALHCYARTKLGEKYGTDVVPQDKPIPAHLLGNMWAQEWGNIYDLVAPKQAATNVDV
TKLLVKAGYDPIKMTKTAEGFFTGLGFEPLPQTFWERSQITRPRDREVVCHASAWDIDDK
DDIRIKMCMRVNGDDFQTVHHELGHNFYQRAYKAQSTLFRNGANDGFHEAIGDFIALSVT
PGYLVKLGLLDKEPSTEGDVPLLLQQAMDKVAFLPFGLLIDKWRWNVFNGNIKPEDYNKA
WWDLRTKYQGVSSPVERTAADFDPGAKNHVPTSVPYVRYFLARILQFQFHKAACDQAGFT
GPLHRCSIAGNAEVGAKFKAMLEMGASKPWPEALKTFTGTDQMDASAMLAYFAPLKEWLD
KQNEGKSCGWE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcaccaagcatctgcgtgccggggtcgccctcagtgcgatgattatcctggca
gcctgcgggcagccgggcgacaaacagactgcggcacccgcgaagccgaccgtggaagaa
gccaccgccttcatcaccaaggccgaggccgaattgggtgccgcgcgggagaaggcgtcg
cgcactgcctgggtgcagaacacctatatcacgccagacacgctggccctggccgccgac
agcaacgcctcctacagcgcgctggtgtcgcgcctgacggcggagagcaagcggttcgtc
gggctggaactgccggccgatgtggcgcgtaagctgaacctgctgcgcatggaaacggcc
ctgccgtcgcccgccgacccggcgctcaacaaggaactggccgagctggacgccaagctg
ggtgagttgtacgccaccggcaaggtctgccgcgacgatggcagcgactgtctgacgctg
gacgagatcgacgatgtcttccgcacctcccgcgacgagaaggagctgaagcggctctgg
gccggctggcacaaggtcgggcaggagatgaagccgctgtaccagcgtgaggtggagatc
gccaatatcggcgccaaggaactgggcctgcccgatgccggcaccctgtggcggtcgggc
tatgacatgccgccggaggcgttcgagcaggaggccgaccggctgtggggtcaggtgaag
ccgctttatacggccctgcattgctatgcccgcaccaagctgggtgagaagtacggcacc
gatgtcgtgccgcaggacaagccgatcccggcccatctgctgggcaatatgtgggcgcag
gaatggggcaacatctatgatctggtggcgcccaagcaggcggccacgaatgtcgatgtc
accaagctgctggtgaaggccgggtacgacccgatcaagatgacaaagacggccgagggc
ttctttacgggcctgggctttgaaccgctgccccagaccttctgggaacgttcgcagatc
acccgcccgcgcgaccgcgaggtcgtgtgccatgcgtctgcctgggatatcgacgacaag
gacgatatccgcatcaagatgtgcatgcgggtcaacggcgacgacttccagaccgtccat
cacgagctgggccataatttctatcagcgcgcctacaaggcccaatcgaccctgttccgc
aacggcgccaatgatggcttccacgaggccatcggcgacttcatcgcgctctcggtaacg
ccgggctatctggtgaagctgggcctgctggacaaggaaccctcgaccgagggcgacgtg
ccgctgctgctgcaacaggccatggacaaggtggcgttcctgccgtttggcctgctgatc
gataagtggcgctggaatgtcttcaacggcaacatcaagccggaagattacaacaaggcc
tggtgggatctgcgcaccaagtatcagggcgtgtcctcgcccgtggagcgcacggcagcg
gatttcgatccgggtgccaagaaccatgtgccgaccagcgtgccctatgttcgctatttc
ctggcccgcatcctgcagttccagttccacaaggccgcctgtgatcaggccggcttcacc
ggcccgctgcaccgctgctccatcgctggcaatgccgaggtgggggcgaagttcaaggcc
atgctggaaatgggcgcgtccaagccctggccggaagcgctgaagaccttcaccggtacc
gatcagatggacgcgtcggctatgctggcctatttcgcaccgctgaaggaatggctggac
aagcagaatgagggcaagagctgcggttgggagtga

DBGET integrated database retrieval system