KEGG   Niveispirillum cyanobacteriorum: C0V82_13440Help
Entry
C0V82_13440       CDS       T05262                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ncb  Niveispirillum cyanobacteriorum
Pathway
ncb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ncb01100  Metabolic pathways
ncb01110  Biosynthesis of secondary metabolites
ncb01130  Biosynthesis of antibiotics
ncb01230  Biosynthesis of amino acids
Module
ncb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ncb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C0V82_13440
Enzymes [BR:ncb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C0V82_13440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_33 AAA_18 AAA dNK TsaE AAA_22 AAA_17 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AUN31130
UniProt: A0A2K9NDA5
LinkDB All DBs
Position
eg_1:2895275..2895832
Genome map
AA seq 185 aa AA seqDB search
MSVTVLPIPKTLVLIGLMGAGKTSIGKRLAAKLGLPFVDADHEIERAAGCTIQEIFDRFG
EAGFRDGERRVIARLLDQPVQVLSTGGGAFMDEATRQTIRDHGISIWLRADLDLLVHRTA
RRDHRPLLRQGDPRAVLGRLMDIRYPVYAQADLTVDSDDSPPDVTTDRVIAALRQWLGDA
DSSAA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgacggtgctgcccatccccaagacactggtgctgatcggcctgatgggggcc
ggcaagaccagcattggcaagcgcctggccgccaagctgggcctgcccttcgtcgatgcc
gatcatgagattgagcgggcagccggctgtaccatccaggaaatctttgaccggtttggg
gaggcggggttccgcgacggcgaacgccgcgtcatcgcccggctgctggaccagccggtg
caggtcctgtccacgggcggcggcgccttcatggatgaggcgacgcgccagaccatccgc
gaccatggcatctccatctggctgcgcgccgatctggacctgctggtccaccgcaccgcc
cgtcgcgaccaccggcccctgctgcgccagggtgacccgcgcgcggttctgggccggttg
atggatatccgttaccccgtctatgcccaggccgacctgaccgtggacagcgacgacagt
ccccccgatgtcaccaccgaccgcgtcatcgcggcgcttcgccaatggctgggcgatgcc
gacagcagcgccgcctga

DBGET integrated database retrieval system