KEGG   Niveispirillum cyanobacteriorum: C0V82_24915Help
Entry
C0V82_24915       CDS       T05262                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ncb  Niveispirillum cyanobacteriorum
Pathway
ncb00500  Starch and sucrose metabolism
ncb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C0V82_24915
Enzymes [BR:ncb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     C0V82_24915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Bac_rhamnosid6H
Motif
Other DBs
NCBI-ProteinID: AUN33582
UniProt: A0A2K9NKI5
LinkDB All DBs
Position
unnamed1:complement(953921..956314)
Genome map
AA seq 797 aa AA seqDB search
MTRTLRSTALTVTGTLAALLMCGTALAATAPGAPGAKPTFSYAGKDGIGTSYEAYVKGRY
QDGGVTGPVSKVWFSLAHGVITETMQGMIHEAQLRELQFAVKGDGFVHTEYDDMETHVDY
LHKDAAGRPLSLAYKIVNRDRQGRYEIEKHVFTDPDRDTLFVRTIFRALKTGITPVLLAD
PQMAGTGSNDKADTVGGTLNAVEGTHALVIKADKPFVKASVGFVGASDGLSQLRKDGALT
AYDTTGAKAGNVALAGELPTLSAGQEATYDVAVAFGADRAAANAMADASLKVGYAATLAK
FNGQGDAVGWEDYIQGLAPLKDLAAMATDGGSLAFVSALVLKAQEDKTYAGALIASLSAP
WGETVSTEKLATGYKAVWPRDFYQCAMALLALGDTQTPLAAFNYLKTVQVSAQTKGNKGA
NGWFLQKTHVDGTIEWVGVQLDQTAMPIMLGWKLWQAGVVDEATLKAMYPTMLKPAADFL
VKGGKIGLDWNKETITPPNSQQERWEEQPGHSPSTTAAIVAGLISAAEIADKLGQAEDAK
TYRATADAINGAIEARMFTTQGTYGNGRYFLRVNQNDNPNDKGPVNAANGQQGLTENVYL
DGGFLELVRYGVRAPNAESIVDSLGELDDMSIPDHFRVKYEFKFAGDPATYPGWRRYGND
GYGEDIRNGGNYGTGELTGGMGVGQRGRVWPIFTGERGHYELARASAKPGGVTAAELDSI
RMTYVRGMEKFANEGMMIPEQVWDGVGVSPKGYKLGEGTNSATPLAWSHAEYVKLLRSVR
DRQVWDLYAPVVARYGK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaccttgcgcagcaccgccctcaccgtcactggcacccttgccgccctgttg
atgtgtgggacggccctggccgcgaccgcaccgggtgcaccgggggccaagcccaccttt
tcctatgccggcaaggacgggatcggcacctcctatgaggcctatgtgaagggccgctat
caggatgggggcgtgacggggccggtgtccaaggtctggttctcgcttgcccatggcgtc
atcaccgagaccatgcagggcatgatccatgaggcgcagcttcgtgagctgcaatttgcc
gtgaagggcgacgggttcgtccataccgaatatgacgacatggaaacccatgtcgattat
ctgcacaaggatgccgccgggcggcccctgtcgctggcctacaagatcgtcaaccgcgac
cgtcagggccggtatgagatcgaaaagcatgtcttcaccgatcccgaccgcgacacgctg
ttcgtgcggaccatcttccgcgcgctgaagacagggatcacgcccgtcctgctggccgat
ccgcagatggcgggcacgggcagcaatgacaaggccgacacggtcggcggcacgctgaac
gccgtggagggcacgcatgcgctggtcatcaaggcggataagccgtttgtgaaggccagc
gtcggctttgtcggcgcgtcggacgggttgagccagctgcgcaaagacggtgcgctgacg
gcttacgatacgacgggggccaaggcgggcaatgtggcgttggcgggggaactgccgacg
ctgtctgccgggcaggaggcgacctatgatgtggccgtggcgttcggggccgaccgcgcc
gccgccaatgccatggccgatgccagcctgaaggttggctatgccgcaacgctggccaag
ttcaacgggcagggcgatgccgtggggtgggaggattacatccagggcctggcgccgctg
aaggatctggcggccatggcgaccgatggcggcagcctggcctttgtgtcggccctggtg
ctgaaggcgcaggaggataagacctatgccggcgccctgatcgcatccctgtcggcgccg
tggggcgagacggtatcgaccgaaaagctggccaccgggtacaaggccgtctggccgcgc
gacttctatcaatgcgccatggcgctgctggcgctgggcgacacgcaaacgccgctggcc
gccttcaactatctgaagacggtgcaggtgtcggcccagaccaagggcaacaagggcgcc
aatggctggttcctgcaaaagacccatgtcgatggcaccatcgaatgggtcggcgtgcag
ttggaccagacggcgatgcccatcatgctgggctggaagctgtggcaggcgggtgttgtg
gatgaggcaacgctgaaagccatgtacccgaccatgttgaagccggcggcggatttcctg
gtcaagggcggcaagatcgggctggattggaacaaggaaaccatcaccccgcccaacagc
cagcaggaacgctgggaagaacagccgggccattcgccctccactacggctgccatcgtg
gcggggctgatcagtgcggcggaaatcgccgacaagctgggccaggcagaagacgccaag
acctatcgcgccacggcggatgccatcaacggcgccatcgaggcgcggatgttcacgacc
cagggcacctacggcaatggccgttacttcctgcgcgtcaatcagaacgacaatcccaat
gacaagggccccgtgaacgccgccaatgggcaacagggcctgacggagaatgtctatctg
gatggcgggttcctggagctggtgcgctatggcgtgcgggcgcccaatgccgagagcatt
gtcgatagcctgggcgagttggacgacatgtccatccccgaccatttccgcgtgaaatat
gagttcaagtttgccggcgacccggcgacatatcccggctggcgccgttatggcaatgac
ggctatggcgaggatatccgcaatggcggcaattacggtaccggcgagctgacgggcggc
atgggcgtggggcagcgcgggcgtgtctggcccatcttcaccggggagcgcgggcattat
gagctggcccgtgccagtgccaagcccggcggcgtgacggcagcggagctggacagcatc
cgcatgacctatgtccgcggcatggagaagttcgccaatgaaggcatgatgatccccgag
caggtgtgggacggggtcggcgtgtcgcccaagggctataagctgggcgaagggacgaac
agcgccacgccgctggcctggagccacgccgaatatgtgaagctgctgcggtcggtgcgc
gaccggcaggtttgggacctgtatgcgccggtcgtggcgcggtacgggaagtga

DBGET integrated database retrieval system