KEGG   Niveispirillum cyanobacteriorum: C0V82_25990Help
Entry
C0V82_25990       CDS       T05262                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ncb  Niveispirillum cyanobacteriorum
Pathway
ncb00564  Glycerophospholipid metabolism
ncb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C0V82_25990
Enzymes [BR:ncb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C0V82_25990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 HI0933_like GIDA GMC_oxred_N Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AUN33878
UniProt: A0A2K9NLC4
LinkDB All DBs
Position
unnamed2:226565..228136
Genome map
AA seq 523 aa AA seqDB search
MTNGLDRAGGIAALADATTWDLVIIGGGATGLGTALDAAARGYRTLLLEGHDFAKGTSSR
ATKLVHGGVRYLAQGNIPLVRHALHERGRLLANAPQVTRRQGFVVPCYRWWDMAFYGAGL
FAYDLLAGRLGLGRSRLLSRAEVMRRLPTVKTEGLVGGIHYYDGQFDDSRLALTLAASAA
DHGATLLNYVRVTGLLKDDGRIAGVTARDMETGTDYRIQARAVVNAAGIFMDEIRHMDRP
DLAEGLSLSQGIHLVLDPDFLSSDDAILIPKTDDGRVLFVLPWLGRTVIGTTDTPIETAS
LEPRALEAEIQFLLEHAAEYLTRVPTRSDVLSVFTGIRPLVKVKGASGTSAVPRDHVLMV
SDSGLVTITGGKWTTYREMAEQTVDAAAKAGHLTPKPSPTKDLRLHGWTPRERIDSADPL
AAYGADAPKVRAVLAEQKGWDAPMHPDLPYALGEAAYAARHLMARTVEDVLSRRTRALLL
NATAAIAAAPAVAKVLAAELGKDAEWIDRQVAEFTELAGVYRV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacggattggaccgcgcaggcggcatcgcggccctggcggatgccacgacctgg
gacttggtcatcatcggcggtggggctacgggcctgggtacggccctggacgccgccgcg
cgcggatatcgcacgctgctgctggaggggcatgatttcgccaagggcacgtcgtcgcgc
gccaccaagctggtgcatggcggcgtgcgctatctggcgcagggcaacattcccctggtc
cgtcacgccctgcatgaacgcggtcggctgctggccaacgcgccgcaggtgacgcggcgg
caggggttcgtcgtgccttgctatcgctggtgggacatggccttctatggcgcgggtctg
ttcgcctatgatctgctggccggcaggctgggcctgggccggtcgcggctgttgtcgcgg
gcggaggtgatgcggcggctgccgaccgtcaagacagagggtctggtcggcggcatccat
tattatgacgggcagtttgatgacagccgcctggccctcaccctcgcggccagtgccgcc
gatcatggcgccaccctgttgaactatgtccgggtcaccggcttgctgaaggacgatggc
cgcatcgcgggcgtcacggcgcgggatatggaaacgggcaccgattaccgcatccaggcc
agggccgtggtcaatgccgccgggattttcatggatgagatccggcacatggaccggccc
gatctggccgagggattgtcgctgagccagggtatccatctggtcctggacccggatttc
ctttccagcgatgacgccatcctgatccccaagaccgatgatggccgcgtgctgttcgtg
ctgccctggctgggccggaccgtgatcggcaccaccgacacgcccatcgaaaccgccagt
ctggagccgcgcgccctggaggcggaaatccagttcctgctggagcatgcggcggaatat
ctgacgcgggtccccacccgatcggacgtgctgtcggtctttaccggcatccgcccgctg
gtgaaggtgaagggcgcgtcgggcacgtccgccgtgccgcgcgaccatgtgctgatggta
tcggacagtggccttgtcaccatcaccggcggtaaatggaccacctatcgcgagatggcg
gaacagacggtggacgccgccgccaaggccgggcaccttacccccaagcccagccccacg
aaggacctgcgcctgcatggctggaccccgcgcgaacgcatcgacagcgccgacccgctg
gccgcctatggcgctgatgcgcccaaggtgcgcgccgtcctggccgaacagaagggctgg
gacgcccccatgcatcccgacctgccctatgcactgggcgaagcggcctacgccgcccgc
cacctgatggcccgcacggtggaagatgtcctctcccgccgcacccgcgccctgctgctg
aatgccaccgccgccatcgccgccgcacccgccgtggcaaaggtcctcgccgcagagctg
ggcaaggacgccgaatggatcgacaggcaggtcgccgaattcacagaattggcaggcgtg
tacagggtgtag

DBGET integrated database retrieval system