KEGG   Notothenia coriiceps (black rockcod): 104940785
Entry
104940785         CDS       T04920                                 

Gene name
cul1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04110  Cell cycle
ncc04114  Oocyte meiosis
ncc04120  Ubiquitin mediated proteolysis
ncc04141  Protein processing in endoplasmic reticulum
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
ncc04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104940785 (cul1)
   04120 Ubiquitin mediated proteolysis
    104940785 (cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104940785 (cul1)
   04340 Hedgehog signaling pathway
    104940785 (cul1)
   04350 TGF-beta signaling pathway
    104940785 (cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104940785 (cul1)
   04114 Oocyte meiosis
    104940785 (cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ncc04121]
    104940785 (cul1)
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     104940785 (cul1)
SSDB
Motif
Pfam: Cullin
Other DBs
NCBI-GeneID: 104940785
NCBI-ProteinID: XP_010764065
UniProt: A0A6I9MRK2
LinkDB
Position
Unknown
AA seq 739 aa
MSSNRTQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSS
QGRGSVPPAKPPKKSTTPGGAQFVGLELYKRLKEFLKNYLTSLLKDGEDLMDECVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVT
NAVLKLIERERNGETINTRLISGVVQSYVELGLNEEDAFAKGPTLSVYKEYFECQFLTDT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKVYVQTTLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTRMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDSYTVQQLTDSTQIKTDILVQVLQILLKSKLLVMEDENANVDE
VEFKPETVIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQVTVHTSYI
HLTALEEKNTETNMRSGGR
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgtcgtcgaacaggacccaaaacccccacggactgaaacagataggcctggaccagata
tgggacgacctgcgggcgggcatccagcaggtttacacacggcaaagcatggccaagtcg
cgctacatggaactctacacacatgtatataactattgtaccagcgtgcaccagtccagc
cagggccggggctccgtgcctccagccaagccccctaaaaagtccaccaccccgggcggg
gctcagtttgtaggcctggagctctacaagcggctcaaagagttcctgaagaactatctg
accagcttgctcaaggatggcgaggatctaatggacgagtgtgtgttgaagttttacacc
cagcagtgggaggattaccgtttctccagtaaagtcctcaacgggatctgcgcctacctc
aaccgtcactgggtcagacgagagtgtgacgagggacgcaagggcatctacgagatctac
tcgctggcacttgtgacctggagagaatgtttattccgacctctcaacaaacaggtaaca
aacgctgtgctgaagctgattgagcgggagcggaatggcgagaccattaacacccggctg
atcagcggggtggttcaatcctacgttgagctgggtctgaacgaggaggacgccttcgcc
aaaggccccacgctgtccgtgtacaaggagtactttgagtgtcagttcctcacggacaca
gagcgcttctacacccgcgagagcaccgagttcctgcagcagaaccccgtcacagagtac
atgaagaaggcggaggctcgtctgctggaggagcagcggcgtgtgcaggtgtatctccac
gagtccacacaagacgagctggcccggaagtgtgagcaggtcctgatcgagaagcacctg
gagatcttccacaccgagttccagaacctgctggatgccgacaagaatgaagacctgggc
cggatgtacaacctggtgtcccgcatcacagatggcctcggagaactgaagaaacttctg
gagactcacatccacaaccagggcctggctgccatcgagaagtgtggagaggccgcgctc
aacgaccccaaagtgtacgtgcagaccacgctggacgtccataagaaatacaacgccttg
gtcatgtctgccttcaacaacgacgccggctttgtggcagcgctcgataaggcgtgtggt
cgcttcatcaacaacaacgccgtcaccaggatggctcagtcctccagcaagtctccagag
ctgctggccagatactgcgactctctactgaagaagagctctaaaaatccagaggaagca
gaactggaggacacactcaaccaagtgatggttgtgttcaagtacatcgaggacaaagat
gttttccagaagttttacgctaagatgctggccaaacgtctggtccaccagaacagcgcc
agcgacgacgccgaggctagcatgatctccaaactcaagcaagcatgcggcttcgagtac
acgtccaaactgcagcgcatgttccaggatattggagtcagtaaagacctgaacgaacaa
ttcaagaaacacctgaccaactctgagcctcttgacttggacttcagtatccaggtcctc
agctctgggtcttggcctttccagcagtcctgcaccttcgctctgccttccgagctggag
cgaagctatcagcgcttcactgcattttacgccagcagacacagcggcaggaagctcacc
tggctctaccacctgtccaaaggagagctggtcactaactgcttcaagaacaggtacacg
ctgcaggcctccaccttccagatggccatcctgctgcagtacaacacagaggacagctac
accgtgcagcagctgaccgacagcacgcagatcaaaactgacattctggttcaagttctg
cagattttgttaaaatccaagctgcttgtgatggaggacgagaacgccaacgtggacgag
gttgagttcaaacccgagaccgtcatcaaactcttcctgggatacaagaataaaaagctg
agggtgaacatcaacgtaccgatgaagacggagcagaaacaggagcaggaaacgacccac
aagaacatcgaagaggaccggaagctcctcatccaggtgactgttcacacatcttatatt
cacctcacagccttagaagagaaaaacactgagacaaacatgagatctggtggaaggtag

DBGET integrated database retrieval system