KEGG   Notothenia coriiceps (black rockcod): 104940789Help
Entry
104940789         CDS       T04920                                 

Gene name
ezh2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104940789 (ezh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104940789 (ezh2)
Enzymes [BR:ncc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104940789 (ezh2)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104940789 (ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     104940789 (ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC SDA1 RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 104940789
NCBI-ProteinID: XP_010764066
LinkDB All DBs
Position
Unknown
AA seq 799 aa AA seqDB search
MVLTGKRSEKGPACWKRRVKSEYMRLRQLKRFRRADEVKSMFNTNRQKIIDRTKVLNQEW
ETRRIQPVHIMTSVGSLRGTRECTVDSGFSEFPRQVIPLKTLNAVASVPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVSALS
QYSDNEDDEEEEQQDFKVEKVEKVEKVEKVEKVELCDSKEHSEDPRKDGLINNDSRSSSD
GSKKFPSDKIFEAISSMFPDKGSTEELKEKYKELTEQQLPGALPPECTPNIDGPNARSVQ
REQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNLENLVDSKPCVMDCYMYLVQDGL
VREYPAGVVSDQVKTPSKRSVGRRRGRLPNGRPSTPSVFSETKDTDSDREGSKEDERDNE
QDNEQDNEQDNDHDNEQEMEQENGGENDKDDDDKKDENTSSSEGNSRCQTPVKMKLSVEA
EAVDWSGAEASLFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIARAPAEDEDT
PPRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVTAQNFCEKFC
QCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQ
RGAKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLF
NLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYR
YSQADALKYVGIERELEMA
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacagggaagcgctcggagaaaggcccggcatgctggaagagaagagtgaag
tcagagtacatgaggctgcggcagctcaagcgcttccgacgagccgacgaggtcaagagc
atgttcaacaccaaccgtcagaaaatcatagatcgcactaaagttttgaatcaggagtgg
gagaccaggcgaatccaaccagtgcacatcatgacgtccgttggctctttgagaggcacc
cgggagtgcacggtggacagcggcttctcggagttccctcggcaggtcatccccctgaag
accctcaacgccgtggcctcagtccccgtgatgtactcctggtcccccctgcagcagaac
ttcatggtagaggatgagacggtgctccataacatcccctacatgggagacgagatcctg
gaccaggacgggactttcatagaagaactcatcaagaactacgacggcaaagtccacgga
gacagagagtgcggcttcatcaacgatgagatattcgtggagttggtcagcgctctctcg
cagtacagtgacaacgaggacgatgaggaggaggagcagcaggacttcaaggtggagaag
gtggagaaggtagagaaggtggagaaggtggagaaggtggagctgtgtgacagcaaggaa
cattcagaggacccgcgcaaagacggactcatcaacaatgacagccgaagcagtagtgac
ggcagcaagaagtttccctctgacaagatctttgaagccatctcctccatgttccctgac
aaaggctccactgaggagctcaaagagaagtacaaggagctgacggagcaacagctgccc
ggagcgttgcctcctgagtgcacgcctaacatcgacggtcccaacgctcgctctgtgcag
cgcgagcagagtcttcactccttccacacgctgttctgcagacgctgcttcaaatacgac
tgcttcctccaccctttccatgcaactccaaacacgtataagcgcaagaacctggagaac
ctggtggatagtaagccctgcgtcatggactgctacatgtacctggtacaggatgggttg
gtgagggagtacccggccggagtggtttcagatcaggtcaagacgccctccaaacgctcc
gtgggtcgtcgccgcggacgactgccaaacggccggcccagcaccccctccgtcttctcg
gaaaccaaagacacagacagcgaccgggagggcagcaaggaagacgagcgagacaacgaa
caggacaacgaacaggacaacgaacaggacaacgatcatgacaacgagcaggaaatggag
caagagaacgggggagaaaatgataaagacgacgatgacaagaaggatgaaaacaccagc
agctcagagggtaactcacggtgtcagactccagtgaagatgaagctgagtgtggaggct
gaagctgtggactggagtggagcagaagcttctctctttagggttctcatcgggacttac
tacgacaacttctgcgccattgcacggctcatcggcacgaagacctgcagacaggtttat
gagttcagggtcaaggaatcgagcatcattgcacgcgctcctgctgaagacgaggacacg
cccccgcggaagaagaagaggaaacacagactttgggccactcactgcaggaagatccag
ctgaagaaagatggctcatccaatcacgtgtataactaccagccatgtgaccacccgcgg
cagccctgcgactcctcctgtccctgcgtcaccgctcaaaacttctgcgagaagttctgc
cagtgcagctctgagtgtcagaaccgtttcccaggctgtcggtgcaaagctcagtgcaac
accaagcagtgcccctgctacctggcggtgagagagtgtgaccccgacctgtgcctgacg
tgcggcgctgcagatcactgggacagcaagaacgtgtcctgcaagaactgctccatccag
agaggcgccaagaagcatctgctgctggccccctcagatgtggccgggtggggcatcttc
atcaaagagccggtccagaagaacgagttcatctccgaatactgtggagagattatctct
caggacgaagcagaccgcagaggcaaggtctacgataaatacatgtgcagcttcctcttc
aacctcaacaacgactttgttgttgatgccacaaggaaaggcaacaagatacgctttgcc
aaccattctgtcaaccccaactgctatgcaaaagtgatgatggtgaacggggatcacagg
attggaatctttgctaagagagccatccagactggagaggaacttttctttgactacagg
tacagccaggcggacgctctgaagtacgtcggaatcgagcgggagctagagatggcctaa

DBGET integrated database retrieval system