KEGG   Notothenia coriiceps (black rockcod): 104940878
Entry
104940878         CDS       T04920                                 

Definition
(RefSeq) cullin-3
  KO
K03869  cullin 3
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04120  Ubiquitin mediated proteolysis
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104940878
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104940878
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ncc04121]
    104940878
   03400 DNA repair and recombination proteins [BR:ncc03400]
    104940878
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     104940878
DNA repair and recombination proteins [BR:ncc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     104940878
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 104940878
NCBI-ProteinID: XP_010764187
UniProt: A0A6I9MI82
LinkDB
Position
Unknown
AA seq 673 aa
MPQWCRFRSQCFLNAFWVSSFTFPLCVFVSQDRVYVQQNNVENVYNLGLIIFRDQVVRYG
CIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAE
FFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKT
IVEMENSGLVHMLKNGKTDDLACMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEG
KNPVDYIQGLLDLKSRFDRFLVESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDK
LKKGVKGLTEQEVESILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMI
SKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLLTTGVSLGGVDLTVRVLTTGYWPT
QSATPKCNIPPSPRHAFEVFRRFYLGKHSGRQLTLQHHMGSADLNATFYGAIKKEDGAEV
GVGGAQVTGSNTRKHILQVSTFQMTILMLFNNRDKSVFEEIQQETDIPERELVRALQSLA
CGKPTQRVLTKEPKSKEIENGHVFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKV
DDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLRARFLPSPVVIKKRIEGLIEREYLA
RTPEDRKVYTYVA
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgccacagtggtgcagattcagatctcaatgcttccttaatgccttttgggtgtcttcc
tttacatttcctctctgtgtgtttgtctctcaggatcgggtgtacgtacagcagaacaat
gtggagaacgtctacaacctgggtcttatcatcttcagggatcaggtggtccggtatggc
tgcatcagagaccacctccgacagacgctgctggacatgatcgcacgcgagaggaaaggg
gaggtggtggacaggggggccattagaaacgcctgccaaatgttaatgatcctcggcctc
gaggggagatctgtttatgaagaagactttgaggcaccgtttttagaaatgtctgcagaa
ttcttccagatggagagccaaaagttcctggcagaaaacagtgccagtgtgtacattaag
aaagtggaagccagaatcaatgaggagattgagcgggtgatgcactgcctggataaatcc
acggaagagcccattgtcaaggtggtggagcgggagctcatctccaaacacatgaagaca
atcgtagagatggagaactctggcctggtgcacatgctcaaaaacggcaagaccgacgat
ttggcgtgcatgtacaagctgttcagccgggtccccaatgggctgaagaccatgtgtgag
tgcatgagctcgtacctccgggagcaaggaaaggctctcgtgtcagaggagggagagggg
aagaaccccgtagactacatccagggtttgctggacctgaagtcacgcttcgaccgcttc
ctcgtggagtccttcaataatgaccggctcttcaaacaaaccatcgcaggcgactttgag
tacttccttaacctgaactctcgctcgcctgagtacctctcactcttcattgatgacaaa
ctgaagaaaggagtaaaagggctgacagagcaggaggtggagtccatactggacaaggcc
atggtgctgttccgcttcatgcaggaaaaggacgtgtttgagaggtactacaagcagcac
ctcgcccgcaggctgctcaccaacaagagcgtctctgacgactcggagaagaacatgatc
tcaaagctcaagaccgagtgcggctgtcagttcacttctaagctggagggaatgttccgg
gatatgagcatctccaacaccaccatggatgagttcagacaacatctactgacaaccggg
gtgtcactgggaggggtcgacctcactgtaagggtcctgaccacgggatactggccaaca
caatcagcaacacccaagtgcaacatccccccttcaccgagacatgcatttgaagtcttc
agaaggttttatcttggtaagcacagcggcaggcaactcacactgcagcaccacatgggc
tctgcagatctaaacgccaccttctacggtgccatcaagaaggaggatggcgcagaggtt
ggagtgggcggagcccaggttacaggctccaacaccaggaagcacatcctgcaggtctcc
accttccagatgacaatcctcatgctcttcaacaacagagacaagtctgtctttgaggag
atccagcaggagaccgacatcccagagagggagcttgtgcgagcgctgcagtctctagcc
tgcgggaagcccactcagagagtcctcaccaaggagcccaagtccaaggagatcgagaac
ggccacgtgtttacagtcaacgaccagtttacctccaaacttcaccgtgtcaagatccag
acagtggctgctaagcaaggggagtccgacccggagaggaaggagacgcggcagaaagtg
gacgatgacaggaagcatgagatcgaagctgctattgttcgcatcatgaagtccagaaag
aagatgcagcacaacgttctagtagcagaggtcacgcagcagttgcgagcgcggttcctc
cctagccctgtagtcatcaagaagcgcattgaaggactcattgagagggaatatttggca
cgaacaccagaggaccgcaaagtgtacacttacgtagcataa

KEGG   Notothenia coriiceps (black rockcod): 104966179
Entry
104966179         CDS       T04920                                 

Definition
(RefSeq) cullin-3-like
  KO
K03869  cullin 3
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04120  Ubiquitin mediated proteolysis
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104966179
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104966179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ncc04121]
    104966179
   03400 DNA repair and recombination proteins [BR:ncc03400]
    104966179
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     104966179
DNA repair and recombination proteins [BR:ncc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     104966179
SSDB
Motif
Pfam: Cullin
Other DBs
NCBI-GeneID: 104966179
NCBI-ProteinID: XP_010793635
UniProt: A0A6I9PZM5
LinkDB
Position
Unknown
AA seq 715 aa
MSNLKGGTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAY
TMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDI
LMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGA
IRNACQMLMILGLDGRSVYEEDFEGPFLDMSAEFFQMESQKFLAENSASVYIKKVEARIN
EEIERVMHCLDKTTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKL
FSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKIRFDRFLLESFNN
DRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRFM
QEKDVFERYYKQHLGRRLLSNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNT
TMDEFRQHIQTTSASLSGVDLTVRVLTTGYWPTQSATPKCTIPPSPRHAFEVFRRFYLAK
HSGRQLTLQHHMGGADLNATFYGTIKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTIL
MLFNNRDKCTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIETGHVFTVN
DQFTSKLHRVKIQTGGQSLCTTHASQKEKSHLISRPASVQHGTVLLGQRVSFLCI
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgtccaacctcaaaggcggcaccaagaaggacaccaagatgaggatacgagcctttcct
atgacaatggatgagaagtatgtcaacaacatctgggaccttttaaagaatgccatccag
gagatccagaggaagaacaacagtgggttgagctttgaggagctctacaggaatgcctac
accatggtgctccacaagcacggggagaagctctacacgggcctgagggaggtcgtcaca
gagcacctcatcaacaaagtacgggaagacgtcttaaactctctaaataacaactttctg
caaacactgaatcaggcctggaatgaccatcagactgccatggttatgatcagagacatc
ctcatgtacatggaccgtgtctatgttcaacaaaacaacgtggagaatgtgtacaacctc
ggcctcatcatattcagggaccaggtggtccgctacggctgcattcgagaccacctacga
cagacgttactcgacatgatcgctcgtgagaggaagggagaagttgtagacaggggcgcc
atcagaaacgcctgtcagatgctgatgatccttggcctggacggcaggtctgtatacgag
gaggactttgagggtcctttcttagatatgtcggcggaattcttccagatggagagccaa
aagttcctagcagaaaacagtgccagtgtctacattaagaaggtggaggccagaattaat
gaagagatcgagcgagttatgcactgcctggacaagactacagaggagcccattgtcaag
gtggtggagagggagctcatttccaaacacatgaagaccatagtggagatggagaattct
ggccttgtccatatgctcaagaacggaaagacagaagacctggcttgcatgtacaagctg
ttcagccgtgtgccaaatggcctgaaaaccatgtgtgagtgtatgagctcctacctaagg
gagcaaggcaaagctctggtgtcagaagagggagagggcaagaaccctgtcgactatatc
cagggcctgctagacctgaagatacgatttgaccgtttcctcctcgagtcattcaacaac
gacagactctttaaacaaaccatagcaggagactttgagtatttcctcaacctcaactcc
cgctcaccggagtacctctcactctttatcgatgacaagctcaagaagggtgttaaaggg
ttaacagaacaggaggtggagtcgatcctggacaaggccatggtgttgttccgcttcatg
caggagaaggatgtgtttgaaaggtactacaagcagcatctgggtcgcaggctcctcagc
aacaagagtgtctcagacgactcggagaagaacatgatttctaagctcaagacagaatgt
ggctgtcagttcacctcgaaactggaagggatgttcagagacatgagcatctccaacact
accatggatgagttcaggcaacacatacaaaccacgtcggcatctctaagtggtgtggac
ctcacagtaagagtcctcacgacaggctactggcctacacagtcggcaacacctaaatgc
accatccccccctctcccagacacgcctttgaagtctttagaaggttttacctcgctaag
cacagtggtagacaactcacactgcaacaccatatgggcggggcggacctgaacgcaact
ttctacggaactattaaaaaggaggatggctcagaggtgggtgtggggggtgctcaggtg
accggctccaacacccggaagcacatactgcaggtctccaccttccagatgaccattctc
atgcttttcaacaacagagacaagtgtactttcgaggagatccagcaggagacggatatc
cccgagcgggagttagtgcgagcgctgcagtctctggcctgtgggaagccgacacagaga
gtcctcaccaaggagccaaagtctaaagagatcgagaccggccacgtgtttacggttaat
gatcagtttacttccaaactgcacagagtcaaaatacagacaggtgggcaaagcttgtgc
acaacacatgcatcacaaaaagaaaagtcacacctcatttccaggccagcttctgtccag
cacggcactgtattgcttggtcagagagtttcatttctatgcatttaa

DBGET integrated database retrieval system