KEGG   Notothenia coriiceps (black rockcod): 104941277
Entry
104941277         CDS       T04920                                 

Gene name
hhat
Definition
(RefSeq) protein-cysteine N-palmitoyltransferase HHAT
  KO
K24678  protein-cysteine N-palmitoyltransferase HHAT [EC:2.3.1.-]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104941277 (hhat)
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     104941277 (hhat)
SSDB
Motif
Pfam: MBOAT MerT
Other DBs
NCBI-GeneID: 104941277
NCBI-ProteinID: XP_010764660
UniProt: A0A6I9MTA3
LinkDB
Position
Unknown
AA seq 358 aa
MTSKSKAQLAPLPRTEILAYWVLSLGSHLYSFYQLHRFSKEHEAGLERGFQLEKGLVKGF
KRDLSDFEWSFWTEWAKKSLLWTLIGHGVISRLTRIFNPKFRVPALTIYGLLAASSVLGI
KGVSVLLVHVGLSFSVAQLQKPALSWCCNLLLLSTLHIHPLQEIQRGWYKTEEEYYLLVF
SVAVCGLRLISFSLEHCWSPADSGGAVQLGWLFSYTFYHPFFYNGPIISYRDYTEQMQRP
AEECDGDKSGAIYLVLRSGRIILWWCLAEYMIHVMYMHSIQSNETYLEILPPWALGGLAL
ALVQFFFVKYLVLFGFPSMLASMDQLVPPKLPRCVSIMYSFTGMWRHFDAGLYRWLIR
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgacatctaaatcaaaggctcaactggcccctctgccaaggacagagatccttgcatat
tgggtgctgtccttaggctcacatctctactctttctaccaactgcacaggttctccaaa
gagcatgaagcaggattagagagaggattccagttggaaaaaggccttgtcaagggtttt
aaaagggacctttctgactttgagtggagtttctggactgaatgggctaagaagtctttg
ctgtggactctaattggtcatggtgtgatatcaagattgaccagaatctttaatcccaag
tttagggtgccagcactcaccatatatggcctcttagcagccagcagtgtgttggggatt
aaaggtgtgagcgtgctgctggtacatgtgggcctgtcgttttcagtggcccaattacaa
aaacctgctctgtcatggtgctgcaaccttctgctgctctccacacttcacatccatcca
ctacaagagatccagagaggctggtataagaccgaggaggagtactatctgctcgtcttc
agtgtcgctgtctgtggacttcgcctcatcagcttcagcctggagcattgctggagccct
gcagacagtggtggagctgtgcagctcggctggttgttttcatacaccttctatcatccc
tttttctacaatggacccattatctcgtacagagactacactgagcagatgcaaaggcct
gctgaggagtgtgacggggacaaatctggtgccatttacttggtgctcagatcaggacga
atcatactgtggtggtgcctcgcggaatacatgatccatgttatgtatatgcactccatc
caatctaatgagacatacttagagatcctccctccctgggccttgggtggtctggcgctg
gcccttgtccagtttttctttgtgaagtatctggttctgttcggctttccatccatgctg
gcttctatggatcaactagttcccccaaagctccctcgctgtgtcagcatcatgtacagt
ttcacagggatgtggaggcactttgacgccggtctgtatcgatggctcatcaggtaa

DBGET integrated database retrieval system