KEGG   Notothenia coriiceps (black rockcod): 104941347
Entry
104941347         CDS       T04920                                 

Gene name
prkacb
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04020  Calcium signaling pathway
ncc04114  Oocyte meiosis
ncc04140  Autophagy - animal
ncc04261  Adrenergic signaling in cardiomyocytes
ncc04270  Vascular smooth muscle contraction
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
ncc04371  Apelin signaling pathway
ncc04530  Tight junction
ncc04540  Gap junction
ncc04910  Insulin signaling pathway
ncc04912  GnRH signaling pathway
ncc04914  Progesterone-mediated oocyte maturation
ncc04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104941347 (prkacb)
   04310 Wnt signaling pathway
    104941347 (prkacb)
   04340 Hedgehog signaling pathway
    104941347 (prkacb)
   04371 Apelin signaling pathway
    104941347 (prkacb)
   04020 Calcium signaling pathway
    104941347 (prkacb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104941347 (prkacb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104941347 (prkacb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104941347 (prkacb)
   04540 Gap junction
    104941347 (prkacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104941347 (prkacb)
   04912 GnRH signaling pathway
    104941347 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    104941347 (prkacb)
   04916 Melanogenesis
    104941347 (prkacb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104941347 (prkacb)
   04270 Vascular smooth muscle contraction
    104941347 (prkacb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104941347 (prkacb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ncc03019]
    104941347 (prkacb)
   03036 Chromosome and associated proteins [BR:ncc03036]
    104941347 (prkacb)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104941347 (prkacb)
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: AGC group
  PKA family
   104941347 (prkacb)
Messenger RNA biogenesis [BR:ncc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104941347 (prkacb)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104941347 (prkacb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 104941347
NCBI-ProteinID: XP_010764737
UniProt: A0A6I9MJT1
LinkDB
Position
Unknown
AA seq 380 aa
MAQGKDQSFASRLFHRCRKSSQEQKGLESEVPHISEFTIMWDKFMKEFLAKAKEDFLRTW
ESPPQSTTGLDDFDRFKTLGTGSFGRVMLVKHKESNQFYAMKILDKQKVVKLKQIEHTLN
EKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSENHARFYAAQI
VLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEII
LSKGYNKAVDWWALGVLAYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLR
NLLQVDLTKRFGNLKNGVNDIKNHKWFAATDWIAIYERKVEAPFLPKCRGPGDTSNFDDY
EEEDIRVSQTEKCAKEFAEF
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcccagggaaaggaccaatccttcgcaagccgccttttccatagatgtcgtaagagt
agccaagagcaaaaaggactagagagtgaggtgcctcatatctctgagttcaccatcatg
tgggataagttcatgaaagagttcttagctaaagccaaagaagattttttaagaacatgg
gagagtccaccacagagcacaactggcctggatgacttcgataggttcaagactctgggc
actggctcattcgggcgagttatgcttgtcaaacataaagaatcaaatcagttctacgcc
atgaagatcttggacaaacagaaagtggtgaagttgaagcagatagaacacacactaaat
gagaagagaatactacaggccgtgtctttccccttcctcgtcagattggagtacgctttc
aaggacaactcgaacctctacatggtgatggaatacgtgccgggtggtgagatgttctca
cacctcagacgtattggaaggttcagtgaaaaccatgcaagattttatgcagctcagata
gtactcacctttgagtaccttcactccttagacctcatctacagagacctgaagcctgag
aacctgctcatagatcaacatgggtacatccaggtcacagactttggctttgccaaaaga
gtaaaaggcaggacctggacattgtgtgggactcctgagtacctggctccagagatcatc
ctcagcaagggctacaacaaagctgtggactggtgggcccttggagttctcgcctatgaa
atggctgctggttatcctcccttttttgctgatcagcctatccagatctacgaaaagatt
gtgtctggcaaggtacgattcccctctcactttagctctgacctgaaggatctgctgaga
aacctcctccaggtcgacctgacaaagagatttggcaacctgaagaatggtgtgaatgac
atcaaaaatcacaagtggttcgccgcaacagactggattgccatctatgagagaaaggtt
gaagcccccttcttgccaaagtgcagaggaccaggcgacaccagcaactttgacgactac
gaagaggaggacattcgtgtctcgcaaacagaaaagtgtgcaaaagagtttgctgagttc
tag

KEGG   Notothenia coriiceps (black rockcod): 104956098
Entry
104956098         CDS       T04920                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04020  Calcium signaling pathway
ncc04114  Oocyte meiosis
ncc04140  Autophagy - animal
ncc04261  Adrenergic signaling in cardiomyocytes
ncc04270  Vascular smooth muscle contraction
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
ncc04371  Apelin signaling pathway
ncc04530  Tight junction
ncc04540  Gap junction
ncc04910  Insulin signaling pathway
ncc04912  GnRH signaling pathway
ncc04914  Progesterone-mediated oocyte maturation
ncc04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104956098
   04310 Wnt signaling pathway
    104956098
   04340 Hedgehog signaling pathway
    104956098
   04371 Apelin signaling pathway
    104956098
   04020 Calcium signaling pathway
    104956098
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104956098
  09143 Cell growth and death
   04114 Oocyte meiosis
    104956098
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104956098
   04540 Gap junction
    104956098
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104956098
   04912 GnRH signaling pathway
    104956098
   04914 Progesterone-mediated oocyte maturation
    104956098
   04916 Melanogenesis
    104956098
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104956098
   04270 Vascular smooth muscle contraction
    104956098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104956098
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ncc03019]
    104956098
   03036 Chromosome and associated proteins [BR:ncc03036]
    104956098
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104956098
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: AGC group
  PKA family
   104956098
Messenger RNA biogenesis [BR:ncc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104956098
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104956098
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 104956098
NCBI-ProteinID: XP_010781842
UniProt: A0A6I9P100
LinkDB
Position
Unknown
AA seq 169 aa
VTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFAD
QPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFATTD
WIAIYQKKVEAPFVPKFKGPGDTSNFDDYEEEEIRVSFNEKCAKEFAEF
NT seq 510 nt   +upstreamnt  +downstreamnt
gtgacagattttggctttgccaaacgtgtaaagggccggacctggacactgtgtggcacc
ccagaatatctggccccagagatcattctcagcaaggggtataacaaggcagtagactgg
tgggcgctgggggtactggtttatgagatggcagcagggtacccgcctttctttgctgac
cagcccattcagatctacgaaaagatcgtatcagggaaggtgcgtttcccatctcacttc
agctctgacctgaaggacctgctgaggaacctgttacaggtggatctaacaaaacgttac
ggaaacctcaagaacggggtcaacgacatcaagggacacaaatggtttgcaaccactgac
tggattgcgatctaccagaaaaaggtggaagctcccttcgtccccaagttcaaaggacca
ggcgacaccagcaactttgacgactacgaagaggaggagatccgtgtctcctttaatgag
aaatgtgccaaggagtttgcggagttctag

KEGG   Notothenia coriiceps (black rockcod): 104956568
Entry
104956568         CDS       T04920                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04020  Calcium signaling pathway
ncc04114  Oocyte meiosis
ncc04140  Autophagy - animal
ncc04261  Adrenergic signaling in cardiomyocytes
ncc04270  Vascular smooth muscle contraction
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
ncc04371  Apelin signaling pathway
ncc04530  Tight junction
ncc04540  Gap junction
ncc04910  Insulin signaling pathway
ncc04912  GnRH signaling pathway
ncc04914  Progesterone-mediated oocyte maturation
ncc04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104956568
   04310 Wnt signaling pathway
    104956568
   04340 Hedgehog signaling pathway
    104956568
   04371 Apelin signaling pathway
    104956568
   04020 Calcium signaling pathway
    104956568
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104956568
  09143 Cell growth and death
   04114 Oocyte meiosis
    104956568
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104956568
   04540 Gap junction
    104956568
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104956568
   04912 GnRH signaling pathway
    104956568
   04914 Progesterone-mediated oocyte maturation
    104956568
   04916 Melanogenesis
    104956568
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104956568
   04270 Vascular smooth muscle contraction
    104956568
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104956568
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ncc03019]
    104956568
   03036 Chromosome and associated proteins [BR:ncc03036]
    104956568
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104956568
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: AGC group
  PKA family
   104956568
Messenger RNA biogenesis [BR:ncc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104956568
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104956568
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 104956568
NCBI-ProteinID: XP_010782370
UniProt: A0A6I9P4E2
LinkDB
Position
Unknown
AA seq 170 aa
MGNAATAKKGNELESETFVKEFLAKAKEDFLRKWECPAQSTTCLDDFERLKTLGTGSFGR
VMLVKHKGTEQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLDYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFRLVLSSTNSIQIHSVQILNLLFIFCRVS
NT seq 513 nt   +upstreamnt  +downstreamnt
atggggaacgctgccaccgccaagaagggcaacgagctggagagcgagacttttgtaaaa
gagtttctagccaaagccaaagaagatttcttacggaaatgggaatgcccagcacagagc
actacgtgcctagatgactttgagagattaaagaccctgggtactggctcatttggaaga
gtcatgctggtgaaacacaaaggcacagagcaatactttgccatgaaaatactggacaag
caaaaggtggtgaaactcaagcaaatagaacacacactaaacgagaagaggatactacag
gctgtgagcttcccctttctcgtcagacttgattacgcgtttaaggacaactccaacttg
tacatggtgatggagtacgttccaggaggagagatgttctcacacctaagacgaattgga
aggttcaggttagttttgtcatcaactaattccatacaaatacacagtgtccaaatattg
aatttactctttattttctgccgtgtgtcataa

KEGG   Notothenia coriiceps (black rockcod): 104960311
Entry
104960311         CDS       T04920                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04020  Calcium signaling pathway
ncc04114  Oocyte meiosis
ncc04140  Autophagy - animal
ncc04261  Adrenergic signaling in cardiomyocytes
ncc04270  Vascular smooth muscle contraction
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
ncc04371  Apelin signaling pathway
ncc04530  Tight junction
ncc04540  Gap junction
ncc04910  Insulin signaling pathway
ncc04912  GnRH signaling pathway
ncc04914  Progesterone-mediated oocyte maturation
ncc04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104960311
   04310 Wnt signaling pathway
    104960311
   04340 Hedgehog signaling pathway
    104960311
   04371 Apelin signaling pathway
    104960311
   04020 Calcium signaling pathway
    104960311
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104960311
  09143 Cell growth and death
   04114 Oocyte meiosis
    104960311
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104960311
   04540 Gap junction
    104960311
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104960311
   04912 GnRH signaling pathway
    104960311
   04914 Progesterone-mediated oocyte maturation
    104960311
   04916 Melanogenesis
    104960311
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104960311
   04270 Vascular smooth muscle contraction
    104960311
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104960311
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ncc03019]
    104960311
   03036 Chromosome and associated proteins [BR:ncc03036]
    104960311
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104960311
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: AGC group
  PKA family
   104960311
Messenger RNA biogenesis [BR:ncc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104960311
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104960311
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 104960311
NCBI-ProteinID: XP_010786602
UniProt: A0A6I9PEI6
LinkDB
Position
Unknown
AA seq 351 aa
MGNTPTAKKGNEMESVKEFLAKAKEDFLKKWENPAQQTAALDHFERLKTLGTGSFGRVML
VKHKESGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKGHKWFAT
TDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSFTEKCAKEFAEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacacgcccaccgcaaagaagggcaatgagatggagagcgtgaaggagtttctt
gccaaagccaaagaagatttcctgaagaaatgggagaacccagcacagcaaactgcggca
ttggaccactttgagcgtttgaagaccttaggcaccgggtcgtttggtcgagtcatgctg
gtgaaacacaaagagtcgggccagcattttgccatgaagatacttgacaaacagaaggta
gtgaagctgaagcagatagaacacacactgaacgagaaacgcatcctgcaagccgtcagc
ttcccctttctggtgcgactggagcactcttttaaggacaacagtaatctctatatgata
atggagtatgtacccggcggagaaatgttctcgcacttaaggagaatcggtagattcagt
gaaccgcacgcgcgcttctacgcagcccagattgtactgaccttcgaataccttcactcg
ctggatctcatctaccgagaccttaaacctgagaacctgctcattgaccagcaaggctac
atacaggtaacagattttggattcgcaaaacgggtgaagggccgaacctggacgctttgt
gggaccccagagtacctggcaccggagatcatcctcagtaaaggttacaataaagccgtg
gactggtgggctctgggagtgctgatatatgagatggctgccggttacccccccttcttt
gctgaccagcctattcagatttatgagaagattgtatctgggaaggttcgctttccctcc
cacttcagctcagacctgaaggatctgttgagaaatttgctgcaggtggaccttaccaag
cgctttggcaacctcaggaatggagtcaacgatatcaagggccacaagtggtttgccacc
accgattggatcgccatctaccagaggaaggtggaagctccctttattcctaagtgcaaa
ggccccggtgacacgagcaactttgacgactacgaggaagaggaaatcagagtctccttc
acagagaagtgtgcaaaggagtttgctgagttctag

DBGET integrated database retrieval system