KEGG   Notothenia coriiceps (black rockcod): 104941969
Entry
104941969         CDS       T04920                                 

Gene name
hhatl
Definition
(RefSeq) protein-cysteine N-palmitoyltransferase HHAT-like protein
  KO
K24679  protein-cysteine N-palmitoyltransferase HHAT-like protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104941969 (hhatl)
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 104941969
NCBI-ProteinID: XP_010765452
UniProt: A0A6I9MLV8
LinkDB
Position
Unknown
AA seq 538 aa
MGIKSALPKYEIYFYNTVLCLATLWAGSWVLDVSSSGANRKAFKPSVKPGWYYFGRKRDS
ADLEWVMWFSTFREHILFALAGHVLFAKICSMLAPKHRSLVYMVYGILAVWTSLGLTYVT
LILTHCVLLYSVSLVKIRWLCFVTGLCTLATFKCEPFVSWQAGFVDGDFDLRHIFFYGGC
GFTIMRCMSFALENCERKEGSYSILELLKYNFYLPFFYFGPIMTFDKFYVQANKSDLSRK
EWGLWNISLHGLTHLGVVIMVDLLFHFMYILTIPNDLKLLKHSSDWALVGLAYFNLVYDW
VKAAVMFGIINTVSRLDHLDPPRPPKCITMLYMFSETHFDRGINEWLCKYVYDHLGGKHE
NVVEELVASLCTFGVTILWLGPCEVVLVWAFFNCFGLNFELWTAKFFAMEPFASLEIGMS
EATSRRIRAVFNTFNFWSIVLYNILALNSLDFAKLVAKRLLLKGFPFTTIIVMFVTYCLV
QVIKERERRQALIDDPDPLPPAAPPTNTSTTSSSPPTSAAAAPPAAQPVVDPSKEKAE
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggggatcaaatcggctcttcctaaatatgagatctacttctacaacacggtgctctgc
ctggccacgctgtgggccggcagctgggtcctggatgtgtccagctccggtgcaaacaga
aaggcgttcaaacccagcgtgaagccaggatggtactactttgggaggaaaagggactca
gctgatttggagtgggtgatgtggttctccaccttcagagagcacatcctgtttgctctc
gccggtcatgtgctcttcgctaagatctgctccatgttggctccaaagcacaggtctctg
gtgtacatggtgtacgggatcctggccgtgtggaccagtctgggcttgacctacgtcacc
ctgatcctgacgcactgcgtcctgctctacagcgtgtccttggtgaagatccgctggctg
tgcttcgtcaccggcctctgcaccctcgccaccttcaagtgtgaacccttcgtgtcctgg
caggcaggctttgtggacggggactttgatctgcgccacatcttcttctacggaggatgt
gggttcaccatcatgcgctgtatgagctttgctctggagaactgcgagaggaaagaaggg
agctacagcatcctggagctgctcaagtacaacttctacctccccttcttctacttcggg
cccatcatgacctttgacaagttttatgttcaggccaacaagtcggacctgagcaggaag
gagtgggggttgtggaacatcagtctgcacggcctcactcacctgggggtcgtcatcatg
gtggacctcctcttccacttcatgtacatcctgaccatccccaacgacctgaagctgctg
aagcactcctccgactgggcgttagtgggcctggcttactttaacctggtgtacgactgg
gtgaaagcggcggtgatgtttgggatcatcaacacggtgtccagactggatcacctggac
cctccccggcccccaaagtgcatcactatgctctatatgttttctgaaacacattttgac
cgagggatcaacgagtggctgtgcaagtacgtgtacgatcacctgggagggaaacatgag
aacgtggtggaggagttggtggcttcactttgcaccttcggggtcaccatcctgtggctc
ggaccctgcgaggtggtgctggtctgggctttcttcaactgcttcggcctcaacttcgaa
ctgtggaccgccaaattcttcgccatggagcctttcgcttctctagagattggaatgtca
gaagcaacgtcccgccgcatcagagccgtcttcaacacgttcaacttctggagcatcgtg
ctgtacaacatcctggctttaaacagtttggactttgccaagctggtcgccaagaggctg
cttctcaaaggtttccctttcaccaccatcatcgtcatgtttgtcacctactgcctggtt
caagtgatcaaggagagggagaggaggcaggctctcatcgatgatccagatcctcttcct
cctgctgcacctccaactaacacctccacaacctcctcctccccccccaccagcgctgca
gctgcaccccccgctgctcaacctgtcgtagatcctagcaaggagaaagcagagtag

KEGG   Notothenia coriiceps (black rockcod): 104963174
Entry
104963174         CDS       T04920                                 

Definition
(RefSeq) protein-cysteine N-palmitoyltransferase HHAT-like protein isoform X1
  KO
K24679  protein-cysteine N-palmitoyltransferase HHAT-like protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104963174
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 104963174
NCBI-ProteinID: XP_010790036
UniProt: A0A6I9PPC4
LinkDB
Position
Unknown
AA seq 517 aa
MGIKSALPRYELYLYTAVLGVALIWAGSWIFEASSENIDRKAFKESVQPGWHYFGRKMDA
ADFEWMMWFSTFRNHILFALAGHVIFAKIFSLLAPKIGINGCKHRSLIFGVYGGLAVLVT
MGWTYMALVLSHCIILYSVALVKMKWLCLAAGLSALASIKLEPYNSWQEALVTGSFDLQD
VLFYGGCGFSIMRCMSFALENCDKKEGNYTFCDLLRYNFYLPFFFFGPIMTFDKFHAQVN
NTQLTRKEREMWNITTKALLHLGIILVVDVFFHYLYILTIPSDMKLVAKLSDWCLAGLAY
SNLVYDWVKAAIMFGVINTVARLDHLDPPQPPKCITMLYVFAETHFDRGINDWLCRYVYD
YIGGDHDKIFKELLATICTFAITTLWLGPCQLVYIWSFFNCFGLNFELWVAKLFSLPPLS
TIEGFMGGAMSRRIRGVFNAANFWTIILYNVLSLNSLEFAKLVGRRLIFKGFPLSTLSVL
LVTYCGVQLVKERERKEALLEDPEPVKAVDGGKEKAE
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggggatcaagtctgccctgcccagatatgagctgtatctctacacagccgtactcggc
gtggccttgatatgggcaggcagttggatatttgaagcttcaagtgagaatatagacagg
aaggccttcaaagaaagtgtgcagccaggatggcattactttggcaggaaaatggatgct
gcagacttcgaatggatgatgtggttctctacattccgcaatcatatccttttcgctctc
gccggtcacgttatctttgcaaagatattcagcctgctagctccaaagattggtataaat
ggatgtaagcacagatccttgatctttggggtgtacggtggtttggccgtcctggtcacc
atgggctggacctacatggctctggttctgtctcactgcatcatcctctacagcgtcgcc
ctggtcaagatgaagtggttgtgcttagctgccggcctgagcgcgctggcctccatcaag
ctggagccctataactcctggcaggaagccttggtgaccggctcttttgacctgcaagac
gtcctgttctacggaggctgtggcttcagcatcatgcgctgtatgagctttgctttggag
aactgcgataagaaggagggcaactacaccttctgtgacctgctgagatacaacttctac
ctccccttcttcttcttcggacccatcatgactttcgacaagtttcatgcccaggtgaac
aacacccagctgacgcgcaaggaaagggagatgtggaacatcaccaccaaggctttgctg
catctgggaattattctggtggtggacgtcttcttccactacctctacatcctgaccatc
cccagtgacatgaagctggtcgccaagctttctgactggtgtctggctggtctggcttat
tccaacctggtgtatgactgggtgaaggcagccataatgtttggtgtcatcaacactgtg
gctagactggaccacctggaccctcctcagcctcctaaatgtatcaccatgctctatgtc
ttcgctgagacgcactttgacagaggcatcaacgactggctgtgcaggtatgtttatgac
tacattggcggggatcacgataaaatcttcaaggagctcctggcaaccatctgcaccttc
gcaatcaccacgctgtggctgggcccgtgtcagctggtttacatctggtccttcttcaac
tgctttggcctcaactttgagctgtgggtggccaagttgttctccctgccaccactttct
accattgagggttttatgggtggagccatgtcacgcaggatccggggtgtgttcaacgct
gccaacttctggaccattatcctctacaacgtcctctccctgaacagtttggagttcgcc
aaactggtgggaagacgactgattttcaaaggttttcctctgtccaccctctcagtgtta
cttgtgacctactgtggcgtgcagctggtgaaggaaagagagagaaaagaagccctgctg
gaggatcccgagccggtgaaggcagtagatggggggaaagaaaaagcggaatga

DBGET integrated database retrieval system