KEGG   Notothenia coriiceps (black rockcod): 104942714Help
Entry
104942714         CDS       T04920                                 

Gene name
gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00500  Starch and sucrose metabolism
ncc01100  Metabolic pathways
ncc04910  Insulin signaling pathway
Module
ncc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    104942714 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104942714 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ncc01003]
    104942714 (gys1)
Enzymes [BR:ncc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     104942714 (gys1)
Glycosyltransferases [BR:ncc01003]
 Polysaccharide
  Storage polysaccharide
   104942714 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 104942714
NCBI-ProteinID: XP_010766286
LinkDB All DBs
Position
Unknown
AA seq 709 aa AA seqDB search
MPLARSLSVTSLSGLEDWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNASGCKVYFGRWLIEGSPYVVLIDVA
FSAWSLDTWKSELWELCDIGVPWFDREANDAVLFGFLTAWLLGEYAAQSEEPPHIVAHFH
EWLAGLGLILCRHRQLPVATIFTTHATLLGRYLCAGNVDFYNKLADFNVDKEAGDRQIYH
RYCLERSAAHCAHVFTTVSQITAVEAEYLLMRKPDIITPNGLNVKKFSAVHEFQNLHAQS
KHRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVQKII
DKEDFTIMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCVRRIGLFNSAVDRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSELLDWKY
LGRYYISARHMALAKAFPDTYMYEPTEPTSTSGFSYPRPASVPPSPSLSRHSSPHHSEVE
DNDEEERYDEDVEAEKDRKNIRQPYALPFKNKTSPLGANGNGNGDDDEN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgcagcctctctgtcacgtccttgtctggactggaggactgggacgag
gagtttgatttggaggacgctgtcctttttgaaattgcgtgggaggtcgctaacaaagtt
ggaggcatctacaccgtcatccagaccaaagcccgtctgaccgcagaggaatggggggag
aactatttcctggtgggtccctatgtggagagcaacgtgcgcactcaggtggagctgatc
gagcccaccaacccggtgctgaagagaaccatcgacaagatgaacgccagtgggtgtaag
gtgtactttgggcggtggcttattgaaggcagtccctatgttgttctgatcgatgtggcg
ttctctgcctggtctctggacacctggaagagcgagttgtgggagctttgtgacatcggc
gtgccttggtttgatcgtgaggctaacgacgctgtgctgttcggcttcctgacggcctgg
cttctgggagagtatgcagcccagagtgaggagcctccacacatcgttgctcatttccat
gaatggttagcaggtctgggtctgattttgtgccgacacagacagctgcccgtcgccacc
atcttcaccacccacgccactctgctaggaagatacctgtgtgctggcaatgtggacttc
tataacaaacttgcagattttaacgtggacaaggaggccggcgatagacagatctaccac
cgctactgtttggagcggtcggccgctcactgtgcacatgtcttcaccactgtatcacag
atcactgccgtcgaggcagagtacctgctcatgaggaaaccagacattatcactcccaac
gggctcaacgtaaagaagttctcagctgtacacgagtttcaaaaccttcacgctcagagc
aagcatcggatccaggagttcgtcaggggacatttctacgggcaccttgacttcaacctg
gacaagtgtttgttcctcttcattgctggacggtatgagttctccaacaaaggagccgac
atcttcttggaagcgttagccagactcaactatctgctgagggtcaatcacagtgacgtg
acagtcattgcgttcttcatcatgccagctcggacaaacaactttaatgttgagacactg
aagggccaagcagtcaggaaacagctctgggatacagctcagactgtgaaggaacgtttt
ggaaagaaactttatgaatcacttctagttgggcagctgcccgatgtgcagaagatcatt
gacaaagaggacttcactataatgaaacgggccatcttcgcgactcagagacagtgccag
cctccagtctgcactcataacatgctggaggacagcagcgaccccatcctcaactgtgtg
cgccgtatcggccttttcaacagcgctgtcgaccgtgtcaagattatcttccatccagaa
ttcctctcgtccacctctcctcttcttcctatggattatgaggagtttgtaagaggctgc
cacctcggcgtcttcccctcttactacgagccttggggctacactccagccgagtgcacg
gtgatgggaatcccatcaatctccaccaacctgtcaggcttcggctgtttcatggaggag
cacatagcagacccctcagcatatggtatttacatcctggaccggcggtatcggggggtc
gacgagtcgtgtaaccagctcacgtccttcctgtttcagttctgcaagcagagcagacgc
cagcggatcatccagaggaaccgcaccgagcgtctgagcgaactcctggactggaaatac
ctcggcaggtattacatatccgcccgtcacatggccctggctaaagcgttccctgacacc
tacatgtatgaacctactgagcccacctccacctcaggtttcagttacccgcgacccgcc
tctgtgcctccgtctccatctctgtcccgccactcctccccccaccacagcgaggtggag
gacaacgatgaagaggagcgctacgacgaagatgtggaggcagaaaaggaccgcaagaac
atccgccagccctacgccctgccgttcaaaaacaaaacctctcccctgggggccaatgga
aacggcaatggtgacgatgatgaaaactga

DBGET integrated database retrieval system