KEGG   Notothenia coriiceps (black rockcod): 104942790
Entry
104942790         CDS       T04920                                 

Definition
(RefSeq) casein kinase I isoform gamma-2-like
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104942790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104942790
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104942790
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104942790
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 104942790
NCBI-ProteinID: XP_010766384
UniProt: A0A6I9MIZ2
LinkDB
Position
Unknown
AA seq 317 aa
MPGKTGSRSGHGSRGTSSNSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLE
PIKSRAPQLHLEYRFYKQLGSSEGVPQVFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTF
SLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGRPGSKRQHTIHIIDFGLAKEYID
PETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKA
DTLKERYQKIGDTKRDTPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFD
RNGYIFDYQYDWTGKPL
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcccgggaagacagggagtcgatcggggcacggaagccggggaaccagctccaactcc
ggggttctgatggtcggaccaaatttccgggtcgggaagaagatcggctgtgggaacttt
ggagagctgcgacttgggaagaacttgtacaccaacgaatacgtggctatcaaactggag
cctatcaagtcccgggcgccacagcttcacctagaatatcgcttctacaaacagctgggg
agttcagagggtgtgccccaggtattttactttggaccgtgtggtaaatacaacgctatg
gttctggagctgctgggacccagcctagaagatctgtttgacctctgtgaccggaccttc
tctctgaaaactgtcctcatgatagctatacagctgatcacccgcatggagtttgtccac
accagaagcttgatctatcgggacgtgaagcctgaaaacttcctggtgggccgaccgggc
tccaaacggcaacacaccatccacatcatagacttcggcctggccaaggaatacattgac
ccagagacgaagaaacacatcccatacagagagcacaagagtctgactggaacggctaga
tacatgagcatcaatacacatctggggaaagagcaaagccggcgggatgatttggaagct
ctaggtcacatgttcatgtacttcctgcgaggcagcctaccctggcagggcctcaaggct
gacactctgaaagaacgttatcagaagataggagacacaaagagagacacacctatagag
gtcctctgtgaaaacttcccagaagagatggccacctacctgcggtacgtgcgtcgactg
gacttcttcgagaagccagattacgactacctgaggaaactcttcacagacctcttcgat
aggaacggatacatctttgactaccagtacgactggactgggaagcctctg

KEGG   Notothenia coriiceps (black rockcod): 104942864
Entry
104942864         CDS       T04920                                 

Definition
(RefSeq) casein kinase I isoform gamma-2 isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104942864
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104942864
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104942864
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104942864
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 104942864
NCBI-ProteinID: XP_010766469
UniProt: A0A6I9MJA0
LinkDB
Position
Unknown
AA seq 449 aa
MDFEKRGGKGETEEGKKMSKTTGSRTGHGGRSSGTNSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGNSEGIPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGSKR
QHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRNSYVFDYEYDWVGKSLPTPIGPIPGDTPLQPSSRDKAQQQTK
NQSPEPKGSESQPTPVTNKETLGSHLTAERLGGSVQVMSSTNGELNTDDPTAGHSNAPIN
APTEVEVADETKCCCFFKRRKRKALQRHK
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggattttgaaaagagagggggcaagggagagacagaggaagggaaaaagatgtctaag
acaacaggcagcaggactggacatgggggccgaagttcagggaccaattccggagttctt
atggttggaccgaacttccgtgtgggtaaaaaaatcggctgcgggaactttggagagctg
cggttgggaaaaaatctctatactaacgaatatgtcgccatcaaattggaacctataaag
tccagggcgccgcagctccacttggagtatagattttacaaacagttgggaaattcagag
ggaatccctcaggtgtactactttggtccttgcgggaaatacaacgccatggtgctggag
ctgctcgggcccagtctagaggacctgttcgacctctgtgaccgaaccttctccctcaag
accgtcctcatgatagccatacagctgattacgcggatggagtacgtccacaccaagagt
ctgatatacagagacgtgaagccagagaacttcctggttgggcggcctggaagcaagagg
caacacaccatccacatcatcgactttggtctggccaaagagtacatagaccccgagacc
aaaaaacacatcccctaccgggagcacaagagtctgactgggacggcgcgctacatgagc
atcaacacacacttgggaaaagagcaaagcagaagggacgatctggaggcgctgggtcac
atgttcatgtacttcctccgaggaagtcttccctggcagggcctgaaggcggacactttg
aaggagaggtatcagaaaatcggggacaccaaacgagcgacacccattgaagtgctttgt
gaaagcttccctgaagagatggccacctacctgcgctatgtgaggaggctggacttcttt
gagaagcctgattatgactacttgaggaagctcttcactgatctgttcgacaggaacagc
tacgtctttgactatgaatatgactgggtcggcaaatcacttcccacaccaataggccct
atccccggtgacacgcccctgcagcccagcagcagagacaaagcacaacagcagaccaaa
aaccagtcgcctgagcccaaaggaagtgagtctcagcccactccagtgaccaataaggag
actctggggtcgcacctcacagctgagcggctggggggctctgttcaggtgatgagttca
acaaatggcgagctgaacactgatgatcccacagccggacactccaacgctcccatcaac
gctcccactgaggttgaagtggctgacgaaaccaagtgctgttgtttcttcaaaaggaga
aagaggaaagccctccagaggcacaagtga

KEGG   Notothenia coriiceps (black rockcod): 104957640
Entry
104957640         CDS       T04920                                 

Definition
(RefSeq) casein kinase I isoform epsilon-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04068  FoxO signaling pathway
ncc04310  Wnt signaling pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104957640
   04340 Hedgehog signaling pathway
    104957640
   04068 FoxO signaling pathway
    104957640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104957640
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104957640
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104957640
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104957640
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104957640
SSDB
Other DBs
NCBI-GeneID: 104957640
NCBI-ProteinID: XP_010783586
UniProt: A0A6I9PC25
LinkDB
Position
Unknown
AA seq 245 aa
PTDFSVSDSFSCLVSTEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKK
MSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNM
LKFGASRTAEDGERERERRAVDDERVAGAPRVSASRGLPPGPLPAAANRVRNGPEQAVSN
PASRVQQSGNTSPRAISRAERERKVSMRLHRGAPANVSSSDLTARHDASRISTSQVSVPF
EHLGK
NT seq 740 nt   +upstreamnt  +downstreamnt
caccaactgacttctctgtttctgactccttctcctgccttgtgtccacagagcagtcca
gacgtgacgacctggagtctctgggctatgtcctcatgtacttcaacctgggctccctcc
cctggcagggcctcaaggccgccaccaagagacagaagtacgagcgaatcagtgagaaga
aaatgtccacgcccatcgaggttctctgcaaaggatacccctccgagttctccacatacc
tgaatttctgccgttcgcttcgttttgacgacaagccggactactcttacctacgacagc
tcttcaggaatctcttccaccgccagggattctcctacgattacgtcttcgactggaaca
tgctcaaatttggtgccagtcgaacagctgaggacggggaacgggagcgggagcggaggg
cggtagatgacgagcgggtcgcaggagcccccagagtgtcggcatcgcggggcctcccac
cggggcccctccctgcagctgccaacagagtgaggaacgggccggagcaggccgtctcca
accccgcctcgcgggtgcagcagtccgggaacacgtcgcctcgtgccatctctcgtgcgg
agagggagaggaaggtgagcatgcggctgcaccgcggagcccccgccaacgtgtcgtcct
ctgacctcacagcccgccacgacgcatccagaatctccacatcgcaggtcagcgtgccat
ttgagcacttggggaagtag

KEGG   Notothenia coriiceps (black rockcod): 104963492
Entry
104963492         CDS       T04920                                 

Gene name
csnk1d
Definition
(RefSeq) casein kinase I isoform delta isoform X1
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
ncc04540  Gap junction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104963492 (csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104963492 (csnk1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104963492 (csnk1d)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104963492 (csnk1d)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104963492 (csnk1d)
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104963492 (csnk1d)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104963492 (csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 104963492
NCBI-ProteinID: XP_010790390
UniProt: A0A6I9PRP3
LinkDB
Position
Unknown
AA seq 357 aa
MMQGGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIE
YIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTA
RYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPI
EVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGA
NRAAEEAERERRDREDRLRHGRTPGARAVPAASGRPRAAVEGAPATPLTPTSHTANTSPR
QVSGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQMMSGVQTAGLHLLAPR
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgatgcaaggaggagtgggcattccaaccataaagtggtgtggagcagaaggagactac
aacgtgatggtgatggagctgctggggcccagtctggaggatctcttcaacttctgctct
cgcaagttcagcctgaagacagtcctgctgctcgctgatcagatgatcagtcgtattgag
tacattcactccaagaacttcatccacagagatgtgaagcccgataacttcctgatgggt
ctgggcaaaaagggcaacttggtctacatcatcgactttggcctggctaaaaagtatcgc
gatgccagaacacaccagcacatcccctaccgagagaacaagaacctgaccggcaccgcc
cgctacgcctcaatcaacacacatctggggattgaacagtcgaggcgtgatgacctggag
tcactgggctatgttctcatgtattttaacctcggctcattgccctggcaaggcctcaag
gctgctaccaagagacagaagtatgagcggatcagtgagaagaaaatgtccacccccatt
gaggttctttgcaagggatacccctctgagtttgcaacctacctgaacttctgtcgctcc
ctgcgcttcgatgacaagccggactactcgtacctccggcagctcttcaggaacctgttc
cacagacagggcttctcctacgactatgtgtttgactggaacatgctcaagtttggagcc
aaccgtgcagcagaggaagcagagagggagcggcgggaccgggaggacaggctgaggcac
ggcaggaccccgggggccagagcagtccctgctgcatcagggcggccccgagcagccgta
gagggagccccagccaccccgctaacacccacctcacacacagcgaacacgtccccccga
caagtgtccgggatggagcgtgagagaaaggtcagcatgcgcctgcaccgcggagctcct
gtcaacgtgtcctcctcagatctgacaggacggcaggacacctcccgcatgtccacctca
cagatgatgtccggtgtacagaccgctggtctccatcttcttgctcctcgatga

KEGG   Notothenia coriiceps (black rockcod): 104967084
Entry
104967084         CDS       T04920                                 

Definition
(RefSeq) casein kinase I isoform gamma-1-like
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104967084
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104967084
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104967084
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104967084
SSDB
Motif
Pfam: CK1gamma_C Pkinase Pkinase_fungal PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 104967084
NCBI-ProteinID: XP_010794781
UniProt: A0A6I9Q4Y8
LinkDB
Position
Unknown
AA seq 411 aa
MYAKFEDDLDLTKGGEGCTALARLMRSHCIMVFNGSLLELCSKVLKHLPDKSTEAFKTMT
NKLIFVSDLVIFVNVDFADCCILSHQISRMEYVHSKNLIYRDVKPENFLIGRQGNKKENI
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENFPEEMATYLRYVRRLDFFEKP
DYEYLRTLFTELFERKGYTFDYTYDWVGRHIPTPVGSSHIDSAASAVTRETHPHRDRPTQ
HPPIRNQTAASDRRGAWEVQPTRQANSSYLTSHLAADRHGGSVQVVSSTNGELNADDPLT
VHSNAPITAQAEVEVVDEAKYVSYARHISPICPSASSFLSRSSSLSLTTLC
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtatgccaagtttgaagatgaccttgatctgacgaagggtggtgaaggatgtactgcc
ctggcccggctcatgagatcccattgcataatggtctttaatggctcactgctggagctg
tgcagcaaagtgctcaagcatctccctgacaaatccacagaggcatttaaaacaatgact
aataaactgatcttcgtcagtgacttggtgatttttgtcaatgttgattttgctgactgc
tgtattctctcccatcagatttctcgaatggagtatgtgcactctaaaaacctcatctat
agagatgtaaaacctgaaaactttctcatcggacggcaagggaataaaaaggaaaacatt
atccacatcattgactttggtctggccaaagagtacatcgaccccgagaccaaaaaacac
attccatacagggaacataagagcctgactggcactgcccgatatatgtctatcaataca
catttaggcaaagagcaaagccggcgagatgacctggaggccttaggccacatgttcatg
tatttccttcgtgggagcctaccatggcaaggactgaaggcagacacattgaaagagcga
taccagaagattggagacaccaaacgaaacactcccatcgaggtcctctgtgagaacttc
ccagaggagatggccacctacctgcgatatgtgagacggttggacttctttgaaaagccg
gactatgaatatctgcggactctgttcaccgaactgtttgagaggaagggatacaccttt
gattacacgtacgactgggttggcaggcacatacccacaccagtggggtcttcccacata
gactcggcagcctctgctgtgacgagagagacccatcctcacagagaccggcccacacag
cacccacccattagaaaccagacagcagcctcagaccgacgaggagcatgggaggtgcag
cccacacgccaagcaaactcctcctacctgacctcccacctggcagcggacaggcacggg
ggctcagtgcaggtggtcagctcgaccaacggggagctgaatgcagacgatcccctgacg
gttcattccaacgctcccatcacagctcaggcagaggtggaagtggtcgacgaggccaag
tatgtgtcatacgctcgccacatctctccaatatgtccatctgcctcttcctttctctcc
cgctcttcctctctgtctctcaccactctctgctaa

KEGG   Notothenia coriiceps (black rockcod): 104967472
Entry
104967472         CDS       T04920                                 

Definition
(RefSeq) casein kinase I isoform delta-like
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
ncc04540  Gap junction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104967472
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104967472
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104967472
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104967472
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104967472
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   104967472
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104967472
SSDB
Other DBs
NCBI-GeneID: 104967472
NCBI-ProteinID: XP_010795237
UniProt: A0A6I9Q2J4
LinkDB
Position
Unknown
AA seq 183 aa
ITYRKTDNVRKLIQSLISPFPPTAEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGF
SYDYVFDWNMLKFGANRAVEDAERERREREERLRHSRNPGARGMASASSRARATQEAAAP
SPLNPASHTGLEKERKVSMRLHRGAPVNISSSDLTGRQDASRMSSQALSSRVTPSGLQSA
APR
NT seq 554 nt   +upstreamnt  +downstreamnt
caataacgtacaggaaaaccgataatgttcggaagttgatccaatccctcatttctcctt
tcccccccacagcggagttcgccacctacctgaacttttgccgctcgttgcgtttcgacg
acaagcccgactactcgtacctccgccagctgttcaggaacctgttccaccgacaaggct
tctcctacgactacgtcttcgactggaacatgctcaaatttggggccaaccgggcggtgg
aggatgcagagagggagcggcgggagcgggaagagcgtctgaggcacagcaggaacccgg
gggcccggggcatggcctcggcctcaagcagagccagggcaacacaggaggccgcagccc
cctccccactcaaccccgcctcacacacaggtttagagaaggagaggaaggtgagcatgc
gtcttcatcgcggagcaccagtcaacatctcctcctcagacctgacggggcgccaggacg
cgtcccgcatgtcctcacaggctctgtcctcccgagtcacacccagcggcctccagtctg
cagctccacggtga

DBGET integrated database retrieval system