KEGG   Notothenia coriiceps (black rockcod): 104943035
Entry
104943035         CDS       T04920                                 

Definition
(RefSeq) protein patched homolog 1-like
  KO
K11101  patched 2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104943035
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 104943035
NCBI-ProteinID: XP_010766657
UniProt: A0A6I9MQH7
LinkDB
Position
Unknown
AA seq 1277 aa
MAAAATGWWVGRTEGGEAAVVVVVAGEPFGGMPDIQWMNLDPVKLMEELSQFTRLEGFKE
MLDKAQVGHAYMNRPCLDPSDPDCPLSAPNKELGESPDIAGRLQGGCHGFSRKFMHWQEE
LILGGRVKSSQDILLSAEALQTMFLLMSSKQLYEHFKDDYEIHDINWNEDKATAILESWQ
RKFVEVVHQSIPSNSSQSIQGFSTTTLNDIMKSFSDVSVIRVAGGYLLMLAYACVTMLRW
DCSKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPFLALGIGVDDMFLLAH
SFTVAGTNIPFKERTGDCLRRTGTSVALTSINNMIAFFMAALVPIPALRAFSLQAAIVVV
FNFAMVLLIFPAILSLDLHRREDKRLDVLCCLYSPCSDRVIHLSPHELSDAEQPPTPTTA
TTHTHQYSAGSTITTSTQITTTVQAFTQCDAAGQHIVTILPPTSQISTSPPSVIVCPTSH
PQAVTPSPTTTSVPDPYGSQLFTPTSSSTRDLLAQVEDSKSGKECVPLPFMHWNLSSFAR
DKYAPLLLKPKSKAIVVVLFLGLLGLSLYGTTMVHDGLYLTDIVPRDTKEYDFIDAQFKY
FSFYNMYLVTMDGFDYARSQRLLIQLHNAFNSVKYVVRDSDSKLPRMWLHYFQDWLRGLQ
SAFDADWLAGRITSDSYRNGTEDGALAYKLLIQTGSKKEPFNYSQLTARRLVDAEGLIPA
EVFYIYLTVWVSNDPLGYAASQANFYPHPREWIHDKYDTTGENLRIPAAEPLEFAQFPFY
LNGLRQASDFVEAIESVRSICDEFSRKGVLNYPNGYPFLFWEQYIGLRHWFLLAISVVLA
CTFLVCAMLLLNPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVVILIASVGIGVEFT
VHIALGFLTAIGNRNKRSAVALEHMFAPVVDGAISTLLGILMLAGSEFDFIMRYFFAVLA
ILTLLGMLNGLVLLPVLLSLMGPPSEVTLVDNASRLPVPSPEPPLPPPMTHHGYYTGHHN
PRVSRQQAFSECSDSEYYSEMTTTSGIGEEDYKYCDRSAYIESGLPTATSHILLEASKNP
SFPKLTVVKPFRENAAGTGGRIEPLNESSHNGSQVTCWDGNKQPGLQRLSAQHLPSERPH
LHGRTCQSGPRLQNGRGPQPNRTKGPSYTNSSSALPMQQVSMGGPVTMVTATASVTVAVH
PTLPGAAYQGYMHEGFETDSESDYFEAAKRTRGDKTNFSSCKRDSLELQDLEATQSQTEH
KLGKTQGGLRIQVTKDC
NT seq 3834 nt   +upstreamnt  +downstreamnt
atggctgcagcagcaactgggtggtgggtcggtaggacggagggcggggaggcggctgtg
gtggtggtggtggcaggggagccctttgggggcatgccagatatccagtggatgaatcta
gatcctgtcaagctgatggaggagctgagtcagttcactcgactggaaggatttaaggag
atgttggacaaagcacaggtgggacatgcctacatgaacaggccgtgtttagacccctcc
gaccctgactgccctctcagtgcgcccaacaaggagctaggagagagtcctgacattgcc
gggcgtctccagggtggttgccatggtttcagccggaagttcatgcactggcaggaggag
ctgatcctgggaggtcgggtcaagagcagccaggatattctgctgagtgcggaggctctc
caaaccatgttcctgttgatgagttctaagcagctgtacgagcactttaaagacgactac
gagatccacgacataaactggaatgaagataaggccaccgccatcctggagtcctggcag
aggaagtttgtggaggtggtccaccagagtatcccatccaactccagccagtccatccaa
ggtttctccaccaccaccctcaacgacatcatgaaatcattctccgatgtcagcgtcatc
agggtggccggaggatacctcctcatgctcgcctatgcctgtgtgaccatgctaaggtgg
gattgttccaagtcccagggtgcagtggggctggccggggtgctgttggtggctctgtca
gtggccgcaggactgggtctctgctcactgcttggcctctccttcaatgctgccactaca
caggtgcttcccttcctggcccttggaattggtgtggatgacatgtttctgttggctcat
tccttcacagtggctggaactaacatcccctttaaggaacggacaggagactgtttgcgt
cgcaccggcaccagcgtggccctgacttccatcaacaacatgatcgcattctttatggct
gctctcgtacccattccggccttgcgagcattctctttgcaggcagccattgtggtcgtg
tttaacttcgccatggtgctgctcatcttccctgccatcctgagtttggacctccaccga
cgcgaggacaagcgattagatgtcctctgctgcctgtacagcccctgctctgaccgcgtc
atccacctgtctcctcacgagctgtcggacgctgagcagccgcccacgcctaccacggca
acgacgcacacgcaccagtactcggcgggatccacaatcaccaccagcactcaaatcacc
accacggtgcaggcgttcacgcagtgtgacgcagcaggacagcatattgtcacaatctta
ccacctacctcacagatctccaccagcccgccctccgtcatcgtatgccccacgtcccat
cctcaagccgtcacaccttcccccaccaccacctcagtgccagacccctatggctcccaa
ctcttcacccctacctccagctccacacgggacctcctagcccaggtggaggattccaaa
tcgggaaaggagtgcgtcccactccctttcatgcactggaacctttccagcttcgccaga
gataaatatgcccctctgctcctcaagcctaaaagcaaagccatcgtggtggttctcttt
ctgggcctcctgggtctcagcctgtacgggaccaccatggtgcatgacggcctctaccta
actgacattgtgccacgtgacaccaaggagtatgacttcatcgacgcccagttcaagtat
ttctccttctacaacatgtacctggtcactatggatggatttgattacgcccggtcacag
aggctgctgattcagctgcacaacgccttcaactctgtgaaatatgtggtcagagacagc
gacagcaaactgccccgcatgtggctgcactacttccaggactggctcagaggtcttcag
tctgcttttgatgctgactggctcgcaggcaggattacctctgacagctatcgtaacggc
acagaggacggagcgctggcgtacaagcttctcatccagaccggctccaagaaagagcct
ttcaactacagccagctgactgctcgtcggctggtggatgcagagggtttgatccctgca
gaggtgttctacatttacctcacagtctgggtcagtaatgatcctctgggctacgcagcc
tcccaggccaacttctacccccatcctcgtgagtggattcacgacaagtatgacaccaca
ggagagaatctacgcatcccagctgcagagcccctggagtttgctcagttccccttttac
ctaaacggacttcgccaggccagcgattttgtggaggccatcgagagcgtgcggtccatc
tgcgacgaatttagccgcaaaggcgtgttaaactaccctaacggatacccattcctgttc
tgggagcagtacattggcctcagacactggttcctgctggccatcagcgtggttctggcc
tgcaccttcctggtctgtgcaatgctcctgctcaacccctggactgccggcatcattgtg
tttatcttagctatgatgacagtggagctgtttggcatcatgggtctaattggcatcaag
ctgagcgccatccctgtagtcatcctgatcgcctcggtgggcatcggagtggagtttacc
gtacacattgcactgggcttcctgacagcgattggcaacagaaacaagcgctcggcagtg
gctctggagcacatgtttgctccggtggtcgacggagcgatctccacgctgctgggcatt
ctcatgctggcagggtcagagtttgacttcatcatgaggtatttctttgctgtgttggcc
atcctcactcttttggggatgctgaacggcttggttcttctgccggtcctcttgtccttg
atgggacccccgtctgaggtcaccctggttgataatgccagccgcctgccggtgccttcc
cctgaacccccactgcctccaccgatgacccaccatggatactacaccggccaccacaac
ccgcgggtgtctcgtcaacaggctttttcagagtgttcagactcggagtattactcggag
atgaccaccacctcagggatcggggaggaggattacaagtactgtgatcggagtgcgtac
atagaatccggccttccaactgcaacatctcacatactgctggaagccagcaagaaccca
agcttccccaaacttacggtggtgaagccgttcagagaaaatgcagcaggaactggtgga
aggatcgaaccgctaaatgaatcttcccacaatggatcccaggttacatgctgggatgga
aacaagcagccgggcctccagagactctcggcacaacacttaccaagcgagagacctcac
ttacatgggaggacttgtcaaagcggccccaggctgcagaacggcagagggcctcagcca
aacaggactaaagggccaagctatactaatagcagctccgccctgccgatgcaacaagtc
tccatggggggacctgttaccatggtaacagccacagcttcggtgacagtggctgtgcac
cctaccttgccgggggcggcttaccaaggctacatgcatgaaggttttgaaacggacagt
gagtcggactattttgaggctgctaagaggactcgtggtgacaaaacaaacttttcttca
tgtaaaagagactctttagagctccaggacttggaagcaacacagagccagacagagcat
aaactcggcaagacacaaggtgggttgaggatccaggtaactaaagattgctag

KEGG   Notothenia coriiceps (black rockcod): 104961260
Entry
104961260         CDS       T04920                                 

Definition
(RefSeq) protein patched homolog 1-like
  KO
K06225  patched 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104961260
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 104961260
NCBI-ProteinID: XP_010787823
UniProt: A0A6I9PL66
LinkDB
Position
Unknown
AA seq 999 aa
FLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCCFYSPSANRVIQIEPHAHLDG
ADESHYSPPPSYCTPPPSYHTPPPNYSSPPPSYSSHGFAQQTQITMQSTVQLRTEYDPRT
QAFYTTAEPSSQISVQPMNAAPTRSNPNNDYYSSNPSGSSSSTHGNLNNNSGSRGNGGSR
GSAPFSHHHTAPPSATTTPTASSAPQGDAPTSSGHGPENNSSTRDLLSQHGERSLGLRCL
DPPCSRWTLASFAERHYAPFLLQPTTKVVVIVLFLCLLVVSLYGTTQVKDGLELTDIVPR
ETSEHDFIGAQFKFFSFYNMYVVTQQAEYPKKQRLLHQLHQRFHTVRYVLKEDNGELPHM
WLHYFREWLQGLQQAFDRDWEAGRITQNNYRNGSDDGVLAYKLLVQTGRREKPINFNLLT
RHRLVDADGIINPGAFYIYLTAWVSNDPVAYAASQANIRPHPPEWLRDRTDIMPETRLSI
PAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICSNFSRQGLPSYPNGYPFLFWEQYVS
LRHWLLLCISVVLACTFLVCALFLLNPWTAGIIVLVLSLMTVELFGFMGLMGIKLSAVPV
VILIASVGIGVEFTVHVALAFLTAIGDRHKRAVLALEHMFAPVLDGAFSTLLGVLLLAGS
EFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGPYPEVTPIDGRSQLPTPSPETPPH
VVHFSVRPHNTTIATPTSGAASDSSDSEYSSNTTVSGISQELQNYNLPSHRGHTRAEEQQ
YHLQISRGRAARTEEHRRAGSGNRRTARQPDPPGYNVSLSSQGCNSGPQPAAPQRNSSRD
PKSQPHRQAPPPARPRMDAFETATEAGGHHGSRGHREHSAGHRARSSHNPQPNHHLPHHH
PNPTPYCQPITTVTASASVTVAVHPAPLSNQGPPASSYPGYTTTDSYCQSGDQGTEPVFH
DPHVPLDTHTGARGAYMESMELQDLEFEAAESNNGRRTS
NT seq 3000 nt   +upstreamnt  +downstreamnt
ttcctgcaggctgcggtggtggtggtgtttaactttgccatggtgctgctcatcttcccc
gccatcctcagcatggacctctaccgacgagaagacagacgtttcgacatattctgctgc
ttttacagtccctctgccaatcgggtgattcagattgagcctcatgcacacctggatggg
gcagatgaaagccactacagccctcccccatcctattgtacaccccctccctcgtatcac
acgcctcccccaaactatagcagcccccctccctcctacagcagccatggctttgcccag
cagacgcaaatcaccatgcagtccacggtgcagctcaggacagagtacgaccccaggacc
caggccttctacaccacggctgagccaagttcgcaaatctctgtgcagcccatgaacgca
gctccaacgaggagtaaccctaacaacgactattacagcagcaaccccagcggtagcagc
agcagcacccacggcaatctcaacaacaacagtgggagccgaggcaatggggggtctcga
ggttctgcccccttctcccatcatcatactgcacctccttctgctaccacgactccaact
gctagctcagctcctcagggcgatgcacccacgtcatctggccatggcccggagaacaac
agctccacacgggacctgttgtcccagcacggagaacgctctctgggcctgcgctgcctc
gaccccccctgctcccgctggaccctggcctcttttgctgagagacactatgctccattc
cttctacaaccaaccaccaaggtggttgtgattgtgctgttcctctgcctgctggtagtc
agtctgtacgggaccacccaggtgaaggatggcctggagttgacagacattgtgccgaga
gagaccagcgagcatgacttcatcggtgcccagttcaagttcttctccttctacaacatg
tatgtggtgacacagcaggcggaataccccaagaagcagcgtctgctgcaccagctccac
cagaggttccacactgttcgctacgtgctgaaggaggacaacggagagctgcctcacatg
tggcttcactatttcagggaatggcttcaaggtctccagcaggcatttgacagggactgg
gaggccgggcgcatcacccaaaacaactacaggaatggctctgatgatggcgtcctggcg
tacaagctgttggtgcagacaggacgcagggaaaagcccattaacttcaacctgctgact
cgtcacaggcttgtagatgcagatgggatcatcaaccccggggcattctacatctacctt
actgcttgggtcagcaatgatcctgtggcatacgccgcctcgcaggccaacattcgccca
caccctccagagtggctgcgtgaccggaccgacatcatgcccgagacacgcctcagcatc
ccagctgctgagcccatcgaatatgcacagttccccttctacctcaacgggcttcgggag
actccacagtttgtggaggccattgagagcgtgcgggctatctgcagcaacttcagtcga
cagggcctaccctcctaccccaacggctaccctttcctgttctgggaacagtatgttagt
ctgcgccactggctcctgctgtgcatcagtgtcgtgctcgcctgtaccttcctcgtctgt
gccctcttcctgctcaacccgtggaccgccggcatcatagtgttggtgctttctcttatg
actgtggagctgtttggcttcatggggctaatgggaatcaagctgagtgctgtccctgtt
gtcattctcatcgcctctgtgggcattggagtggagttcaccgtccatgtggctctggct
ttcctgacagccataggggatcgtcacaagcgggccgtgctggctctggagcacatgttt
gctccggtgctcgacggagccttttctaccttattaggtgtcctgttgcttgcgggctct
gagttcgactttattgtcaggtatttcttcgcagtgttggctattcttacagttcttgga
gtactgaatggattggtccttcttccagtattactgtcatactttgggccctatccagag
gtgaccccaatcgatggtcgtagtcagttacccaccccatcacctgagacacctcctcac
gtggtccacttctcggtccgtcctcacaacaccaccatagccacgcccacctctggtgca
gcttcagactcgtcggactcggagtacagctctaacaccacagtgtctggtataagccag
gagctgcagaactacaacctgccctcccacaggggacacactcgagcagaggagcagcag
taccacctccagatcagcagaggcagagcagccaggacagaggagcacaggagagcagga
tcagggaacagacgcacagccaggcagcctgaccctcctggctataatgtgtctttgtcc
tctcagggttgtaattctgggccccagccagcggctcctcagcgtaacagcagcagggac
cccaagagccagccgcaccggcaggccccgcccccagcccgcccgcgcatggacgctttt
gaaactgctactgaggctgggggccatcatggctcacgtggccatagagaacactcagca
ggccacagggcccgctcttcccacaacccacaacctaatcaccacctcccacaccaccac
ccaaaccccaccccttattgtcaacccatcaccacggtaacagcatcagcctccgtcact
gttgctgttcacccagcccccttgtccaaccagggccccccagcttcctcttacccagga
tacacaacaacagacagttactgccaatcaggagatcaggggacggagcctgtcttccac
gaccctcatgtgccactggacactcacacaggggccaggggggcctacatggagtccatg
gagcttcaagatttggagtttgaggcagctgagagcaacaatggcagacggacaagctga

DBGET integrated database retrieval system