KEGG   Notothenia coriiceps (black rockcod): 104943157
Entry
104943157         CDS       T04920                                 

Gene name
hhip
Definition
(RefSeq) hedgehog-interacting protein isoform X1
  KO
K06231  hedgehog interacting protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104943157 (hhip)
SSDB
Motif
Pfam: GSDH EGF_2 DUF5560
Other DBs
NCBI-GeneID: 104943157
NCBI-ProteinID: XP_010766792
UniProt: A0A6I9MQW6
LinkDB
Position
Unknown
AA seq 696 aa
MKHLQFVLVLAIAVNVWECGDAKFGERGEISPRRRRCYDGSLPKRLKKRERKVLLDGSSS
GEVCHRLYPRVSCCPTRRAAYQILHRRDARIFSTNNTECGLLLEEIKCARCSPNAQVLFH
SLDMDKMPHREPDLPRLCQDFCREFYYTCRGHIPELFQADVDEFCQYYGRRDASLCFPDF
QRKQPQGQDSNYLGDEKIEDISRKHKHNCYCAQEVLSGLRQPVALMHCGDGSQRLFVLER
EGIVRILNHDLELIKEPFLDIHKLVQNGLKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQ
ERWAIGPHDHILRVVEYTVSRKNPNQVDTRTVRMLMEVAELHRKHLGGQLLFSPDGLLHI
VLGDGMITLDDMEEMDGLSDFTGSLLRVDVDTDCCTSPYSIPRNNPYFNSTNQPPEIFAH
GLHDPGRCAVDRLQSDNGSLLMLCTDTSGKNTSAGRILEITPGKDYENEPSVYDLQSSGG
APPVGGFIYRGCQSRRLYGSYVFGDKNGNLRILQKATLSDSGEQWQEKALCLGPAGSCGS
MLVGHILGFGEDELGEVYILASSKTMAQSHTAKLYKLIDPKRPLAPKECQRQVEPPELLM
TACSRHCKNGHCTPTGKCCCSPGWEGPFCRVAKCEPVCRNGGVCMEPNKCLCKSGYSGPQ
CEKSEQGMPNDQEKDGILDHIIDMTSYLLDLTSYIV
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgaagcatttgcaatttgtcctggtcctggccatcgcggtcaacgtgtgggaatgtgga
gacgcaaaattcggcgaaaggggagaaattagccccaggaggagaagatgttacgacggg
agcttgcccaagcggctgaagaaaagggagcgaaaagtgttgcttgacggcagcagcagc
ggagaagtttgccacaggttatacccccgtgtgtcctgctgtcccaccaggagagccgca
tatcagatcctgcaccgcagggatgccaggattttctccaccaacaacaccgagtgtgga
cttctcctggaggagatcaagtgtgctcgctgctcccccaatgcccaggtgttgttccac
tccttggacatggataagatgccacacagggagccagacctgccgcgcctctgccaggac
ttctgccgagagttctactacacctgcagggggcacataccagaactgttccaggccgat
gtggacgagttctgccaatactatgggaggagagatgcaagtctgtgctttccagatttt
caacgaaagcaaccgcaagggcaagattccaactacttgggagatgagaaaatagaagat
atcagcaggaaacacaaacacaactgctactgtgcccaggaggtgttgagtggtctgagg
cagccggtggccctgatgcactgtggtgatggatctcagcggctctttgtcctagagagg
gagggaattgtcaggatactcaaccatgacctggagctaatcaaggagcccttcctggac
atacacaagctggtgcagaacggcctgaagggtggagatgaaaggggcctgctaagcctg
gcattccaccccaattacaagaagaatggcaagctctacgtctcctacaccaccaaccag
gagcgctgggccatcggaccacacgaccacattctccgtgtggttgaatacaccgtttcg
aggaaaaacccgaaccaggtggacacccggacggtgcgcatgctgatggaagtggccgag
ctgcacaggaagcaccttggaggtcagcttctgttcagccctgatggtctgctgcacatc
gtcctcggagatggcatgatcaccctggatgatatggaggagatggatggactcagtgat
ttcacagggtccctcctgagggtagatgtggacacagactgctgcacatccccttactcc
ataccgcggaacaacccgtacttcaacagcaccaaccagccacctgaaatatttgctcat
ggattacatgacccaggcaggtgtgcagtggatcggcttcagtcggacaatggaagcctc
ctgatgctctgtacagacaccagtggcaagaacacatccgcaggaagaatactggagata
actccgggcaaagattatgaaaatgagccttcggtctatgacctgcagtccagtggagga
gctccacctgtggggggcttcatctacaggggctgccagtcgagaagactttatggcagc
tacgtgtttggagacaaaaatggtaacctgcggatcctccagaaggctaccttgtcagac
agcggtgagcagtggcaggagaaagctctgtgtctgggcccagctggctcctgtggctcc
atgctggtgggacacatcttgggttttggagaggatgaactaggtgaagtctacatactg
gcaagcagtaaaaccatggcgcagtcccacactgcaaaactctacaagctgatagacccc
aaaaggcccctcgccccgaaggagtgccagcgtcaggtggagccccccgagctgctgatg
acagcttgttcccgacactgtaagaacggacactgcaccccgaccggaaagtgctgctgc
agccccggctgggaggggcccttctgcagagttgccaagtgtgagccagtctgccgcaac
ggaggcgtgtgtatggagcccaacaagtgcctgtgtaagagcggctactctgggccccag
tgtgagaagagtgagcagggcatgcccaacgaccaggagaaggacggcattctggaccac
atcatcgacatgacctcgtacctcctggacctgaccagctacatcgtatag

DBGET integrated database retrieval system