KEGG   Notothenia coriiceps (black rockcod): 104943538
Entry
104943538         CDS       T04920                                 

Definition
(RefSeq) glucocorticoid receptor-like isoform X1
  KO
K05771  glucocorticoid receptor
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104943538
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104943538
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ncc03310]
    104943538
Transcription factors [BR:ncc03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    104943538
Nuclear receptors [BR:ncc03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   104943538
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 104943538
NCBI-ProteinID: XP_010767287
UniProt: A0A6I9MS98
LinkDB
Position
Unknown
AA seq 746 aa
MSITSVVLPSTPLMQPGQVPNGLSNSHLTELSSASVTSTVGPLLEDPEPRGLIKIQKLHQ
QHFLQTQTSTTFGRQHFRESLPQLEASTADINQSCMDSLIGGSDPNFFHTKTEDFSMDRG
DQDPIDLDHAFDHIGKDVDVTQKFFTDNTLDLLQDFELTGSPSDFYVGDDAFLSTLAADT
LLGDVSSERDIKPSLVESINSSGAVSVSLNGSSMTSPGQSSPSISTTSSLTPTATLSAKV
KKEKDAGFIQLCTQGGIKQEKTSAGQSYCQISGAASTASMSTSNTISICGVSTSSGPSYH
FGTTSSSNGAHQQKDQKPVSSLFLPVTTIGGAWSRIQNIGDNSAMLRASEAFSSSSSYPI
SFSSSTSRQEIVPAQSSTKSGTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGKGQH
NYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEARKTKKLNRLKGAQPSNPPELNPS
PPIETRSLLPVKSMPQLVPTMLSLLKAIEPDTIFAGYDSTLPDTSTRLMTTLNRLGGRQV
ISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGNMLCFAPDLVINE
DRMKLPYMADQCEQMLKISSEFVRLQVSHDEYLCMKVLLLLSTVPKDGLKSQAVFDDIRM
SYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHEMVGGLLSFCFYTFVNKSLSVEFPE
MLAEIISNQLPKFKAGSVKPLLFHQR
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgtccatcacctcagtcgttcttccatccaccccgttgatgcagccaggtcaggtgcct
aacggcctcagcaacagccacctaacagagctctcctccgcctccgtcacttccactgtt
ggacccttattggaagacccagagcccagaggcctgatcaaaatccaaaagcttcaccag
cagcactttctccagacacagacttccactacgttcgggcgtcaacactttagggaaagt
ttgccccagttggaggccagtacagcagatattaaccaatcctgcatggattcacttatt
ggaggatcagatcccaatttcttccacacgaaaacagaagatttttcaatggatagaggt
gatcaggatcccattgaccttgatcatgcctttgatcacattggaaaagatgttgatgtg
acccagaaatttttcacagacaacactctggacctgctccaagactttgagctcactggg
tctccctcagatttttatgtaggggatgatgccttcctgtccactcttgcagccgatact
ctgcttggagacgttagctcagagagagacataaagccttccctggttgagagcattaac
agcagtggggcagtctcagtttctctcaatggcagcagtatgacaagtccaggtcagtcc
agcccaagcatatccacaacgtcctccttaacccctacagccactttgtctgcaaaggta
aagaaagaaaaagatgctggcttcattcagctctgcacccaaggcgggatcaaacaggaa
aagacgtctgcaggccagagttattgccaaatcagtggcgcggcctccacagcatccatg
tccacgtctaacaccatctccatctgtggggtgagcacttcaagtggaccaagctaccac
tttggaaccacctccagcagcaatggagctcatcagcagaaggatcagaagccggtgtcc
agtctgtttctcccagtgacgaccatcggcggggcctggagccgaatccagaatatcggg
gacaactccgccatgctccgggccagtgaggcattctccagctcctcctcttaccccatc
agcttttccagttctacctccagacaggaaattgtccctgcacagtcctcgacaaaaagt
gggactcataagatctgcctggtgtgctctgacgaggcctcaggctgccactacggtgtc
ctcacctgtggcagctgcaaggtgttcttcaagagagcagtggaaggtaaagggcagcat
aattacctgtgtgctgggaggaacgactgcatcatcgacaagatcaggaggaagaactgc
cccgcctgccgcttccgcaagtgtctgatggctggcatgaacctggaagcgcgaaaaacc
aagaagctgaaccgcttaaagggcgcccagccgagcaacccccccgagctcaatccctct
cctccaatcgagactcggtccctcttacccgtgaagtccatgcctcaacttgtccccacc
atgctgtccctgctgaaggccatcgagccggacaccatcttcgccggctacgacagcacc
ctgcccgacacctccacccgcctcatgaccaccctcaacaggctggggggccggcaggtc
atctctgccgtcaagtgggccaaggctctgccaggcttcaggaacctgcacctggacgac
cagatgactcttcttcagtgctcctggctcttcctcatgtctttcggcctgggctggaga
tcctaccagcagtgcaacggcaacatgctgtgcttcgccccagacctcgtcatcaacgag
gaccggatgaagctgccttacatggccgaccagtgcgagcagatgctgaagatctccagc
gagttcgtccgcctgcaggtttcccacgacgagtatttgtgcatgaaggtgctgctgctg
ctcagcacagtgccaaaggacggcttgaagagccaggcggtgttcgacgatattcggatg
tcgtacattaaggagctggggaaagccatcgtgaagcgcgaggagaactccagccagaac
tggcagcggttctaccagctcaccaagctgctggactccatgcacgagatggttggtggg
ctgctgagcttctgcttctacacctttgtgaataaatccctgagcgtggagttcccggag
atgctcgccgagatcatcagcaaccagctaccaaaattcaaggccgggagcgtcaaacct
ctcctcttccatcagagatga

DBGET integrated database retrieval system