KEGG   Notothenia coriiceps (black rockcod): 104943539
Entry
104943539         CDS       T04920                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104943539
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104943539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ncc04052]
    104943539
   00536 Glycosaminoglycan binding proteins [BR:ncc00536]
    104943539
Cytokines and growth factors [BR:ncc04052]
 Growth factors
  Growth factors (RTK binding)
   104943539
Glycosaminoglycan binding proteins [BR:ncc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104943539
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 104943539
NCBI-ProteinID: XP_010767290
UniProt: A0A6I9N032
LinkDB
Position
Unknown
AA seq 151 aa
MSGMAEEDMFVSEEEQAVDCRRLTRLYCMNGGHHLQILPEGNVQGQREDGDAHIVLKLKA
VDRGVVVIQGTEAGRYLAMSDEGRLYSSPTVTDECYFLEKLEENHYNTYMPQKYQDRKWY
VGLKKNGKPKLGSRTHIGQKAIFFLPRQLCD
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagcgggatggcggaggaggacatgtttgtatcggaggaagagcaggcggtggactgc
aggcggctaacccggctgtactgcatgaatggcggacatcacttgcagatcctccccgag
gggaatgtgcagggccagagggaggacggggacgcgcatattgttttgaagctcaaagct
gtggacagaggtgtggtggtcatccaaggaacagaagccgggagatatttggccatgagc
gacgagggcagattgtacagctcacccacagtcactgatgagtgttatttcctggagaag
ttggaggagaaccactacaacacatacatgcctcagaaatatcaggacaggaaatggtat
gtcgggctgaaaaagaacggcaaacctaaactgggttcaagaactcacatcggccagaag
gccatcttctttctgccccggcagctgtgtgactga

DBGET integrated database retrieval system