KEGG   Notothenia coriiceps (black rockcod): 104944229
Entry
104944229         CDS       T04920                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104944229
SSDB
Motif
Pfam: GDNF DUF1380
Other DBs
NCBI-GeneID: 104944229
NCBI-ProteinID: XP_010768044
UniProt: A0A6I9MP41
LinkDB
Position
Unknown
AA seq 262 aa
MASSCSLARSVCRCVWPLGCVLLFFGYLSVASPSHGRRLICWQAIMNCQAEPECNYAYEH
YSRACGPVLNGEKRKCPSHCISSLVQLNLTKNGPALEDCSCAHDPVCTGTKRAIEPCLPR
TTSTGCTEARRQCERDGQCSSSMQDYLKHCGKLFSGAICTNACRNVIANMRKIPKGQQLD
TCMCDGTERAICEYVKNSMKALCFDSPVREEGSGSDYGQYPIDDEDPTELYCNEELSSGA
PLPAAHCVLTLLASILALLPLI
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcaagctcttgctctttggcacggagtgtctgtagatgtgtttggcctctcggttgt
gtgcttctgttttttggctacctttctgtggcctcgccgtcccacggtagaaggctgata
tgctggcaagccatcatgaactgccaagccgagcccgaatgcaattacgcatacgagcac
tactcgcgcgcatgtggccccgtgctgaacggggagaagaggaagtgccccagccactgc
atctcctcgcttgtgcagctaaatctgaccaaaaacgggccggctctggaggactgcagc
tgcgcgcacgacccggtgtgcacgggcaccaaacgggccatcgagccgtgcctgcccagg
actaccagcaccggctgcacggaagcccggcgccagtgcgagagagacgggcagtgcagc
tcctccatgcaagactatctgaagcactgcgggaaacttttcagcggggcaatctgcaca
aacgcctgccggaatgtgatcgcgaatatgcgtaaaatacccaagggtcagcagctggac
acatgcatgtgtgacgggactgagagggccatctgtgagtatgttaagaacagcatgaag
gctctgtgcttcgactctccggtgagggaggagggcagcggctcagactacggccagtat
cccatagacgatgaggaccccacggaactatactgtaacgaggagctgagcagcggagcc
cctcttccagcagcccactgtgtgttgaccctgctggcatccatcttggctctattgccc
ctcatttaa

KEGG   Notothenia coriiceps (black rockcod): 104949592
Entry
104949592         CDS       T04920                                 

Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes-like
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104949592
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Y_Y_Y EphA2_TM PTP_tm
Other DBs
NCBI-GeneID: 104949592
NCBI-ProteinID: XP_010774274
UniProt: A0A6I9N8E3
LinkDB
Position
Unknown
AA seq 733 aa
MVLFDLSGVAQMILWAVSSKHPQLGSTAGVLLEASPSLNPMQSDEGHERFPAEDEGEAVN
VPADRRENRPTPEAPIITSPPQTHKPDIYDLEWRSGRDGGNKINAYFVKYRKVDDLGTVV
GSWHTVRVPGSEKTLRLSELEPSSLYEVLMVARSSAGEGQPAMLTFRTGKEKIPTVVKNP
SKPPVISLPPKAAEDKTPTHFGVVIHDRVPEAPDRPTISMATESSVYVTWIPRANGGSPI
TAFRVEYRRGRSAEWVVAADNISPLKLSVEVRNLEPGSSYKFRVMAINMYGESPHSIPSK
IYQVPQASPRIADRPIVGPHISSTDAISDTQIMLRWTYSPTSNNNTPIQGFYIYYRPTDS
DNDSDYKRDVVEGVKPWHMIGHLQAETSYDIKMQCFNDGGESEYSNVMICETKARQSPGS
PSQHPITPSYPHPPDPPSPPGGLLYLIVGCVLGVMVLILLAFIAMCLWRNRQQNNMHKYD
PPGYLYQPAEMNGHVLEYTTLPGSSRLNGGVHGGYGHNGPMLPQGCHHLHHKHPNGSLFS
PGHQHSHDGSLPRSTLDFEHSHPHHHHNGGGMYTALPQTESSDCMSCQNLCNNNRCYNKT
NGTFSSGTLPVMHRMAPCQQDGLEMVPLGQVSSQCQGPDSHMHSGEHGADAGYQPDEHSE
SSPSQHSCCLVGNNENCPADNTAEEELECMDMEGPVVCWESLGLPDLDCDEKPGWISSSS
LAGELIQPGPQEV
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggtgctctttgacctcagtggcgtggctcagatgatcttgtgggctgtgtcctccaaa
catccacagctgggctccactgccggtgtgctgctggaggcttccccctcgctcaacccc
atgcagagcgacgagggccacgagcgcttcccggccgaggatgaaggtgaagcggtcaac
gtgccggccgacaggagagagaaccgacccactccggaggcgccaattatcaccagccca
cctcagacccacaagcccgacatctacgacctggagtggaggtcggggcgtgatggaggg
aataaaatcaacgcctattttgtaaaatatcgcaaggtcgatgatttgggaacagtggtg
gggagctggcacacagtccgtgtccctggcagtgagaagaccctgcggctgtcggagctg
gagccctccagtctctatgaggtgctgatggtggctcgcagctcagcaggcgagggccag
ccggccatgctcaccttccgcaccggcaaggagaagatccccaccgtcgtcaagaatccg
tccaagcctcccgttatctctctgccccccaaagctgcagaggacaaaacgcctacacac
tttggtgtcgtcatccacgacagagtacccgaggcaccagaccgccccaccatctctatg
gcaactgaaagctctgtgtatgtcacctggatcccgagagccaatggagggtctccgatc
acagccttccgggtggagtacagacgtggtcgcagtgcagagtgggtcgtggcggcagat
aatatctcgcctctcaaactgtctgtggaagttcgcaatctggagcctggttcctcgtat
aagttccgtgtcatggccataaacatgtacggtgagagtccccatagcattccctcgaag
atttaccaggtgccccaagccagcccgcgcatcgcagaccgccccatagtcggaccccac
atctcctccactgacgccatcagtgacacgcagatcatgctgcgctggacttatagtccc
acaagtaacaacaacactccaatccaaggcttctacatttactaccggcccacggacagc
gacaatgacagcgactataaaagagacgtggtcgagggtgtgaaaccctggcacatgatt
ggacacctccaggccgagacatcctatgatatcaagatgcagtgctttaatgatgggggg
gaaagtgaatacagcaacgtcatgatctgtgagaccaaagcgcgtcagtccccggggtcg
cccagccagcaccccatcaccccatcctacccccacccgccggaccccccctccccacct
ggggggctgctgtacctgatcgtgggctgtgtcctcggagtgatggtgctcatcctgctg
gcttttatcgccatgtgtctgtggaggaatcgccagcagaacaacatgcacaagtacgac
ccccccggctacctgtaccagcctgcagagatgaacggccatgtcctggagtacactacc
ctgcctggctccagccgcctcaatgggggcgtccacgggggctacgggcacaacggcccc
atgttaccccaagggtgccatcacctccaccacaaacaccccaacggcagcctgttctcc
cccggacaccaacacagccatgatggcagcctgccccgcagcaccctggacttcgagcac
tcgcacccccaccaccaccataatggtggaggcatgtacaccgctcttccccaaacagag
tcgtctgactgtatgagctgtcagaacctctgcaacaataaccgatgttacaacaagacc
aatggcactttctccagcggcactctgcctgtaatgcatcgcatggcgccgtgccagcag
gacggtctggagatggtgcctctgggccaggtttcctcgcagtgccagggccccgacagc
cacatgcactctggtgagcatggggccgacgcagggtaccagccagacgagcacagcgag
tcctcgccctcgcagcattcctgctgtctggtggggaacaatgaaaactgtccagcagac
aacactgctgaggaggagctggagtgcatggacatggaggggcctgtggtctgctgggag
tctctcggcctgcctgacttggactgtgacgaaaagcctgggtggatctccagcagcagc
ctggcaggagagctgatccagcccggcccacaggaggtctga

KEGG   Notothenia coriiceps (black rockcod): 104953345
Entry
104953345         CDS       T04920                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104953345
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 104953345
NCBI-ProteinID: XP_010778584
UniProt: A0A6I9NLT6
LinkDB
Position
Unknown
AA seq 257 aa
MASRSILMERTVLICSVLFLIIGLCVGSPNHSRRLVCWKAILKCHGETECHYAYDQYLYA
CSSVLSGDCKKCPSHCISSLIQLNMTQGGPALEDCDCATDPVCRSTKQAIEPCLPRTSTV
GCTEARRQCEGDHHCSSAMRDYLFHCRKLFGGERCSEDCRRVISNMRTMPKAQQLDTCVC
DGTDRNICEYIKVSMKKFCSDSSDRFAGSGFSDTEEDSEDDYIDQEEYLYEENSSASPPC
RTVLNILTTILVLTKFI
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcaagtcgttccatattgatggagcggacagtgttgatatgcagcgtattattccta
ataatcggcctctgtgtaggatctcctaaccacagtcgtcggctggtttgctggaaagcc
atcctgaagtgccacggagagacggagtgccattacgcttacgaccagtacctttatgct
tgttcctctgtcctcagtggggactgcaagaagtgtccaagccactgcatatcctctctg
atccagctcaatatgacccaaggtggcccggctctggaggactgcgactgcgccacggac
ccggtgtgcaggagcaccaaacaggccatcgagccgtgcctgccgcggaccagcaccgtg
ggctgcaccgaggcccggcggcagtgcgagggggaccaccactgcagctccgccatgagg
gactatttattccactgcaggaaacttttcggaggggaaaggtgctcggaagactgccgc
agagtgatctccaacatgcgcacaatgccgaaggcgcagcagctcgacacttgtgtgtgt
gatggcacggacaggaacatttgcgagtacataaaagtcagcatgaaaaaattctgctcc
gattccagtgataggttcgcgggaagcggattttcagacactgaggaagactctgaggac
gattatatcgaccaggaggaatatctatatgaggaaaactccagtgcctccccaccttgt
cggactgttctaaatatcctgaccaccattttggttttgaccaaatttatctga

KEGG   Notothenia coriiceps (black rockcod): 104953591
Entry
104953591         CDS       T04920                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 2-like
  KO
K06233  low density lipoprotein-related protein 2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104953591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104953591
Membrane trafficking [BR:ncc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    104953591
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 SGL EGF_CA
Other DBs
NCBI-GeneID: 104953591
NCBI-ProteinID: XP_010778843
UniProt: A0A6I9NVH3
LinkDB
Position
Unknown
AA seq 4563 aa
MDLKGLHLLFLLLLSQGIHLAQGSCGSGEFQCTSGQCINKAWRCDGTKDCADDSDELNCP
PPSCTSQEFKCVTSGECISSGFVCDGEEDCIDGSDEQRTCGGQTCSPDQFTCQEGQCVPS
KYRCDHVKDCVDNSDENNCNYPPCTEKTCANGACYNNTQHCNGLQDCRDGSDEFNCTTQH
CPIHQYECANGYCIPRPFVCDHWDDCGDNSDEQGCAYQSCSGGEFTCSSGRCIPQRWVCD
EFNDCGDFSDERGCDSNSRSCYPGEWGCPGSTLCIPVGKVCDEKPDCPGGTDETNATAQQ
TCSLDQCSALSCEYLCHPSPQGGACYCPDGFTVANDSRSCVDYNDCQIWGICDQLCEDRP
GTHHCSCADGYFLEQGHVCKANVSAGLPQLIFTNGGDVMMADIHGRFVRTLVPSQGKGYA
VGVAYHWHSDTVFWSDTNTKKVYSANYNGGNIKEVLTAAVQNVQNLALDWINFKLYVLEA
MMERIDMCDFDGGNRVTLVAENLQTPHGLVLDPTVGYMFFTDMGVSSEQMKLERAFMDGS
NRIELVKKGLGIPTGITLDIVTQRVYWSDSHFDTVETVTYSGLDRKMVLNGATQAPHPFG
IAVFENNVFFTDWTKMGVVRANRFNGSNPALLYRTAKRPGHVVVSHPALQPVVMNPCGRH
NGGCQQICVLSHRSDNDGLGFRCKCSHGYDLHSDRRTCYKVKDFLLLATSLGVRAIPLNL
SLQEDIALPLSGLGTSFFGSAVEFDGKEEAIFYNDRSRGLVYKSNLNGTVQQILTGYRVG
IIDAMAYDWTSKVLFWTTSTYKSVVAFRVADKSRRDVVTGLRNPKGIAVHPSAGYLFWSD
WYRPAVIMKGFTDGSNAVPLVNTTLGWPCGLSVDYVMDRLYWVDYQLEQIGHIGIEGYDR
QTFTNIGQITQPYSLTIYSDYLYVADVRTRGVFEMRKRDGGGNIMIRQGVTGIMNVKAYT
ADLHSAITSRCNVVANGLCSHFCFPTPSYSRVCGCPYGMKLQANQRDCIKDDSVPPPDNN
CGDLAFECDEGRCRPNSYRCDGISDCVDKSDEANCTDTGATCSPNAFTCNNKHCIHSGWR
CDGMDDCGDGSDETNCPTRLPTTCDPSYFTCDNNRCISKIWLCDGDNDCGDGSDEHNCNS
TITTCSPNYFLCPDHRCIFNSYVCDGDQDCLDGSDEKNCEYACASHEFACASGDQCVSST
YQCDGVFDCRDHSDERDCPTRGPGLCHDEEFQCQTDGFCIPKEWECDGHPDCEDASDEHN
SCAPITCRPNYFQCTNKICIPASWLCDGDNDCRDMSDEQNCPTPPFSCPSGQWQCPTDLL
CIDLDKVCNGQRDCPNGADESPICNQDDCGLNNGGCSNGCVQGPFGAQCTCPSGFQLLND
SKTCEDIDECLIPGFCSQQCFNERGSFRCYCSEGYILEPDGRTCKAADPGAATLLVAKRS
QIIANRINMRPPLLRPVVSGSSIVTVDFDRVTSRIYWADASQKKIWSAYQNGTDRREVFS
TGLMVPESIAVDWVGRNLYWTDSVMENIEVSTLDGRFRKVLLTKNVTSPRGLVLDPRNYS
DNKKLITLSFLAPFTNLDVLVDWGQNPRHRAGRETDHGLEHEKGHRQPTNLLLEPNGPRP
GLHHRRHPTMQRAPCTQLCLLAGLRPRLHCHCQSXWKLDAEKRTWSKDDTPFLMVVRDSV
IIGIPLDPADPSNNAMAPVSGISQGRDIDFDDQLQLIYWVQSTGSIWQVKTSGTNRSEFA
PAAFMGSPSGLAFDWIGRIMYYTNPTVKTIEVIRVDGVQHYRKTLITFTGKPEGAGEPIG
IALDPARGKLFWTDKGSDNGVPPKVGSADMDGGNPRNLYTENLANIGYIAADISTRKLYW
GVSGSGVIESGTMDGVTRMAVVNGLSHPWGLTIHENHLYYTDLDYEVIERVDKDNGANMV
VMRSGMSGLRALKVHARDNSAGTANACSSNNGGCLHLCLPTPDNKKTCACTTGFNPSPDG
SRCEQYESFAIVSTSKYIRGFHINSSDHSEAMVPVGGPSYSVKGKLDLHIESGFVYWSDN
STSTSYRGIFRAKTDGGRYSTVLNSGIGKGGIQGFAVDWIAGNLYFTNAFEGETFLEVLA
INTTYRMILLKSSQDQPRDVAVSPKLRYLFWTDGGQTPKIERASLDGTNRTVLASESLAS
PRGLTIDYTNDFLYWTDDVLDMISRMAVDGTQRQIVRYGSRYPSPTGMAIFGNYMLWVDQ
KLGKLLQASKDPANTDQPEVILDNLDGLMDVSIFDAHVQPTSANQVGFNPCHEDNGRCQQ
LCFALPGQEAPKCGCAHGSLLNNGVTCGYGLDEFLVFTTDFTLNSMRLDPADHSTPYPTV
NLGYNLMALDYDFKEKRIFFTQSLGIGRSRIGYVTTTSITTPPVILATNLDDPEGLAYDW
VNKRLYFTDYYSRTVQSIGADGTNRSTIAHANRPRGIIVDPCYGYLYWTDWGYPAKIERA
TLGGNFQTSIINTSLSTPNGLSLDYEERMLYWADSSLDKIERATLTGENRQVIVQGAQYP
YAMTVFKQDIFWTDWTERAVFRAGKDDGSDFAVLAQDMQYRPNDIHVYSASKQESCNSSC
QQFNGGCSNICVSGPLGPECQCPHEGKWYLANNGKDCVKDTGKRCEPDQFTCLSGDCISA
RWKCDGYNDCYDNSDELERVCGERRGLIXLKHVTTVFCCSSCSAFHTCSAMDFTCDNGRC
VPMSYACDYTDDCGDNSDERGCPFPTCNPSTEFTCTNGRCISAAFVCDGHNDCRDNTTSD
EINCPDRTCPAGQIKCERNNICIDPENLCDGYNNCGDNSDENPLFCAGHTCSPDQFRCDG
GKCIPDFWVCDSVRDCNDGTDEPLSCKDQIKTCGPSQFTCTNGNCIPQLLVCDGNNDCWD
DSDEAPELQCGQRTCSSDQFTCLTWFPGYPRCVPLSFVCDGDKDCANAADELQNCPNRTC
HMNEFACSNGLCIFLPYHCDRVNDCGDGSDELGCSYDTCSSSEFTCSNGACTPASFACDG
ESDCMDGSDEADSLCVTTQPTCAPTQYMCKSGECIDINKVCNGQKDCQDNSDEKGCGINE
CRSPSVHKCAQLCTDTLTGFYCSCNAGYRLMPDGKACEDLDECTSTPAVCSQVCENTVGS
YHCKCAPGYLREPDGRTCRQNSGIAPYLLYSNRYYIRNITTDGSHLSIVLQGLSNVVALD
FDDQEKRLYWLDAGTGKIERMRFDGTDRETLKDDAREVEGLALDWVGRKLYWVDGYYGSV
HVMELDGRYQKRLLSGEFTEGNTTYVISRPRAVAVNPKYGWLYWTDWGDTAYIGRVGMDG
SNISAIITTKLEWPNALTIDYTTNKIFFADSHLNFLDFADMDGKNRHRAIAGTLPHVFAA
SLFEDWVYWTDWNTHTVEKAHKYTGEQRTTMGNNTHRPYDIRVSHPYRQPRSENPCSSHY
LTCSHLCLVAPGGERATCQCPDHFIGLAVGFKIQCVADCSSTQFRCGDNEKCVSIWWKCD
GQSDCGDGSDEPQTCPPRFCPIGQFQCQDGNCTYPGFLCDGHSDCPDSSDEDAALCSDHR
CQENQFQCKNKKCIPVSWHCDGVNDCGDGSDEDADMCSQRTCTPGQFRCANGRCLPSSYV
CDAQDDCGDGSDEPYETCMGPDYKCDADTEFSCKTNYRCVPQWARCDGTNDCIDNSDEQG
CEEVTCDPLGDFRCDNHRCVPIRWQCDGSDNCGDGSDERNCQPRPCSESEHRCDDGQCIP
GNWVCDYDNDCGDNSDERDCEFQTCRPGSFQCGSGHCVPAALQCDGRPDCQDLSDETSCP
TRYPGGRWCPQNEFQCANRLCVSQSWVCDGEDDCGDRSDEQLTLCLSVTCELPFRFRCAN
GYCLYSGLMCNQKDDCGDGSDEKEELCREPTLPPCTLEEFKCTNGHCVALPYVCDHNDNC
GDRTDELGCNFGQDRNCDEKLCQHECTNLNGTGFICSCRPGYTVDPVSTYTCMDIDECEV
FGTCPQVCKNTKGGYDCECSQGYRKVGNGNMCEAEGTTPLLLLPENIRIRRFNLQTEAYH
DFLREEEHIMALDYDWDHNDTGLSVVYFTVAGKDSAAGAIKRAYIPSVDDGSNNIGAAVD
LGIKYITTPDGIAVDWVGRNLYWADSRVKRLEVAMLDGRYRKQLVKTDLGHPSAVAVNPR
LGMLYWADRGEAAKIECSWLDGQERKVLVSDGLGWPTGLSIDFTNGDRVYWSDSKESRIE
SVLPSGEGRRTAVYIDVRNPFSVSVFEDHVYWSTQEKGEVFRQDKFGRGSKTKLLTAGPW
LTQVSVYQQQRYNSLDMKSPCKGTCSHLCLLRPGGYTCACPQGTSLIPGSHTECDAGFDP
PPTMPPQCQCQNGGTCYFDDNKALCKCPPEWTGDYCQKNKYDAVTSSIGIAIGVTALIVV
LLGALVYAARKKSSLLSLLPSMPSMPSMPSMPNLPSFRNSASPNASRTEESEAGLNCEAV
PCMSVSMLETDVKSFENPAYQVEEQPPSTSAVAATSANERNMMNPLYVEEVKVVDEPSRS
ANTPTVNMEPFENPSFGSDVEDIDVASTQQPASSIQRLEPIDDESFGSFQNPTYAEQRPD
SDI
NT seq 13692 nt   +upstreamnt  +downstreamnt
atggacctaaaagggcttcatcttctgtttctcctactgctgtcccaaggaattcatctt
gctcaaggaagttgtggcagtggagagtttcaatgcacttctggacaatgcatcaacaaa
gcttggaggtgtgatgggactaaagactgtgcagatgactcagatgagctgaactgtcca
cctccatcatgcacctcgcaggagtttaagtgtgtaacaagcggtgaatgcatctcttcg
ggatttgtctgcgacggagaggaagattgtattgatggatcagatgaacaaagaacttgt
ggtgggcagacctgcagcccggaccagttcacctgccaggagggccagtgtgtccccagc
aaatacagatgtgaccacgtaaaggactgcgtggacaactctgatgagaacaactgcaac
tatcccccttgtactgagaagacgtgtgccaatggggcctgttacaacaacactcagcac
tgcaatgggctgcaggactgtagagatggctctgatgaattcaactgcacgacacagcac
tgtcccatccaccagtatgagtgtgcaaacggctactgtatccctcgtccgtttgtctgt
gaccactgggatgactgcggggacaacagcgatgagcaaggctgtgcgtaccagagctgt
agtggcggtgagttcacatgttcgagtggccgctgtattcctcagcgctgggtgtgtgac
gagttcaacgactgtggggacttcagtgatgagagaggatgtgatagtaactctcgatcc
tgttaccctggcgagtggggatgcccgggctcgacattgtgtataccagtgggcaaagtg
tgtgacgaaaaacctgactgtcctggaggaaccgatgagaccaacgccacagcacagcaa
acctgcagccttgaccaatgctctgccttgagttgtgagtacctgtgccacccgtctcct
caggggggggcctgctactgccctgatggtttcactgtagccaacgacagccgttcctgt
gtagactataatgactgtcaaatctgggggatctgtgaccagctgtgtgaagatcgtcct
ggaacacaccactgtagctgtgctgatggatacttcttggagcagggtcacgtgtgcaaa
gccaatgtgtcagctggattgccacagctcattttcaccaacgggggtgatgtgatgatg
gcggatatacatggacgttttgtcagaactctggtgccgtcccagggcaaaggttatgct
gtaggtgtggcatatcactggcacagcgacacagtcttctggagtgatacaaacaccaaa
aaggtgtactctgcgaactacaatggggggaacattaaggaggttctgactgctgcagtc
cagaatgtacagaacctcgctttggactggatcaacttcaaactctacgtcctcgaggct
atgatggagcgtatcgacatgtgcgactttgatggagggaatcgggtcacactggtggct
gaaaacctgcagactcctcacggcctggtcctggaccccacagtgggctacatgttcttc
acagacatgggcgtttccagtgagcagatgaagctcgaacgcgccttcatggacggcagt
aatcgtattgagctggtgaagaagggactgggcattccaacaggaatcaccttagatatc
gtgactcagagggtctactggtccgacagccactttgacacggtggagaccgtcacctac
agcggcctggacaggaaaatggtactaaatggtgcaacccaggctccacatccttttgga
attgctgtgtttgaaaacaacgtgttcttcacggactggaccaagatgggtgtggttaga
gccaaccggttcaacggcagcaacccagctctcctctatcgcactgccaagcgccccggc
catgttgtagtgtcacaccctgccctgcaacccgttgtgatgaacccctgcggccgacac
aacggaggctgtcagcagatttgtgtgttgagtcaccgctccgacaatgatggtctgggc
tttcgctgcaagtgtagccatggttacgacctgcattcagaccgccggacctgctataag
gtgaaggacttcctgttgttggccacctctctgggggtgcgggccatcccactgaacttg
tccctgcaggaggacatcgccctgcccctctctgggctcgggacgtctttctttggctca
gctgtggagtttgacggcaaagaggaagccattttctacaacgacaggtccagaggcctc
gtctataagtccaacctcaatggcactgtccaacagatcttaacgggttacagagtggga
ataattgacgccatggcttacgactggacctctaaggtcttgttttggaccacgagcact
tacaagtcggtggtggccttcagagtcgcagacaagtcgagacgagacgttgtgacggga
ttaaggaacccaaaaggaatcgcagtgcatcccagtgctggctacttgttctggtctgac
tggtaccgtcccgcggtcatcatgaaaggcttcacagacggcagcaacgcagttcctctg
gtcaacacaacgctgggatggccgtgtggactttctgttgactacgtgatggaccggctg
tactgggtggattaccagttggaacagattggtcacattggcatcgaaggatacgacaga
caaacgtttaccaatatcggccagatcacacaaccctactccctaaccatctattcagac
tacctgtatgtagctgatgtaaggaccagaggagtattcgagatgaggaagagggatgga
ggaggaaacatcatgatcagacaaggagtcaccggcatcatgaacgtcaaggcctacaca
gctgacctgcacagcgctatcaccagccgctgcaatgtggtggccaacgggctctgcagc
cacttctgtttcccgaccccctcctacagtcgagtgtgtggctgtccatatggcatgaaa
cttcaggccaatcagagggactgcatcaaagacgattctgttcccccacctgataacaac
tgtggagacctcgcctttgagtgtgatgaaggacgctgcaggcccaactcctaccgctgt
gacggaattagtgattgtgttgataagtctgatgaggccaactgcaccgatacaggagcg
acctgctctccgaacgcgttcacctgcaacaacaagcactgtatccattccggttggcgc
tgtgatggcatggatgactgcggggacggctctgatgagacgaactgtcccactcgtctt
cccaccacgtgtgaccccagctactttacctgtgataacaacaggtgtatctctaaaata
tggttgtgtgacggtgacaacgactgcggcgacggctcggatgaacacaactgcaattcg
accatcactacatgctctccaaactacttcctgtgtcccgaccaccgctgcattttcaac
tcctacgtgtgcgatggagaccaggattgtcttgatggctctgatgagaaaaactgtgag
tacgcctgtgcctcccatgagtttgcctgtgccagtggggaccagtgcgtcagttccaca
tatcagtgtgacggagtgtttgactgcagggaccattctgacgagcgagactgtcccacc
cgaggtccaggcctctgccacgatgaggagttccagtgccagacggatggtttctgcatc
ccaaaggagtgggagtgtgacggccatccagactgcgaggacgcgtctgacgaacacaac
tcctgcgcccctatcacctgcaggcccaactatttccagtgtaccaacaagatatgcatc
ccagcaagctggttgtgtgacggcgacaacgactgccgggacatgagtgatgagcagaac
tgccccacccctccattcagctgcccctctggacagtggcagtgccccacggacctgctg
tgcatcgacctggacaaggtgtgcaacggccagagggactgccccaatggagccgatgag
tcgcctatttgcaaccaagatgactgtgggctgaacaacgggggctgcagtaacggctgt
gtccaaggaccgtttggggctcagtgcacctgtccgtcaggatttcagcttctcaacgac
tccaagacctgcgaagacatcgacgagtgtctgatcccaggtttctgcagccagcagtgc
ttcaacgagagaggaagcttccggtgctactgctcagagggttacatcctagagcctgat
gggcgcacctgtaaagctgcagacccaggagcagctacacttctggttgccaagcgaagc
cagatcatcgccaatcggatcaacatgagaccccccctgttgcgtccagttgtcagcggt
tcgagcatcgtgactgtggactttgatcgtgtaacttccagaatatactgggcagatgcc
tcgcagaagaagatatggagtgcctaccagaacggcaccgacagacgggaagtgttctcc
accggtctgatggtaccagagagtatagctgtggactgggtggggcggaacctttattgg
accgactctgtgatggagaacattgaggtctcaactctggacggtcgctttcggaaagtc
cttctcaccaagaatgttaccagcccccggggactggttttagacccccgaaactacagc
gataacaaaaaactcatcacactgtcattcctcgctccattcaccaaccttgatgttctg
gtcgactggggtcagaaccccaggcatcgagcgggccgggaaacagaccatggattggag
catgagaaaggtcatcgtcagcccacaaacctcttactggagcccaacgggcctcgccct
ggactacaccaccgcaggcatccaaccatgcagagagcaccgtgcactcagctgtgtctg
ctggcaggcctcagaccccgtctacactgccactgtcagtctngctggaagctcgatgcc
gaaaaacgcacctggtcaaaagatgacactcccttcttgatggtggtgagagattctgtg
attattggcattcccctggaccccgctgacccttccaacaatgcaatggccccagtgtcc
ggcatcagccaggggcgggacatcgacttcgacgaccagctgcagttaatctattgggtc
caaagcactggttctatatggcaagtgaagaccagcggtaccaacaggtctgagtttgct
ccagctgctttcatgggctcgccgtctggtctggcttttgattggataggccggattatg
tattacaccaatcccactgtgaagaccatagaggttatccgtgtggatggagtccagcac
tacaggaagaccctcatcaccttcactggtaaacctgagggagcaggagagcccattgga
atagccctggatccagcccgagggaaattgttttggacagataaggggtcagacaatgga
gttcccccaaaggttggcagtgctgatatggacggggggaatcccaggaacctctacaca
gagaacctggccaacataggatacatcgctgctgacatctccaccaggaaactctactgg
ggtgtttcgggctcaggggtgattgagagtggtaccatggatggagtcacccggatggcg
gtggtgaacggcctgtcccacccatgggggctgacgatccacgagaaccacctctactac
accgacctggactacgaggtcatcgagagggtggacaaggacaacggggccaacatggtg
gtgatgaggagcggcatgtctggcctgcgcgccctaaaagtgcacgccagagacaattca
gcagggaccgccaacgcctgcagctccaacaacgggggctgtctccacctctgtcttcca
acaccagacaataagaagacctgtgcctgcactacaggattcaacccttctccagacggc
tcccgctgtgaacaatatgagtcgtttgcaattgtctccacatcaaagtacatccgtggc
ttccacataaacagctccgaccactccgaggctatggtgcctgtcggcggaccttcctac
tccgttaaaggcaagttggacctccatattgaatctggctttgtgtactggagtgacaac
agcacctccacctcatacaggggcatcttcagggccaagacagacggaggaagatacagc
actgtcctcaactctggcattggaaaaggaggcattcagggctttgctgtagactggatt
gcaggtaacctatactttaccaatgccttcgaaggcgagacattcctggaggtgcttgcc
atcaacaccacgtaccggatgattctcctcaagtcttcgcaggaccagcctcgtgacgtg
gctgtcagccctaaactccgctacctcttctggactgatggtggccaaacacccaaaatc
gagcgagcctcgctggacggcacaaaccgcactgtgttggcttcagaaagcttagcgtcc
cctcgtggcctgaccattgattacaccaatgatttcctctactggacagatgacgttctt
gatatgatctccagaatggccgtagacggcacacagagacagattgttcggtacgggagc
cggtatccgtctccaacagggatggctatatttggaaactacatgctgtgggtggatcaa
aagctagggaagctcctacaggccagtaaggacccggccaataccgaccagccagaggtt
attttggataatcttgacgggctgatggatgtctctatctttgatgctcatgtccagccg
acatcagccaaccaggtgggcttcaacccgtgtcatgaagataatggacgctgccagcag
ctctgcttcgccctgccaggccaggaggctccgaaatgtggctgtgctcatgggtcactc
cttaataacggagtaacatgcggttacggactggacgagtttctagttttcaccacagac
ttcacgctgaatagcatgaggttagatcctgcagatcacagcaccccctatccaaccgtg
aacttaggctacaacttgatggctttggattatgacttcaaagagaagagaattttcttc
acccagagtttgggaattggtcggagcagaattggctacgtcaccacaacatccatcacc
accccgcctgtcattctggctacaaatttggatgacccagagggattggcgtatgattgg
gtgaacaagcgtctctacttcactgactactacagccgcactgtccaatctataggggcg
gatgggacgaaccgctcaaccatcgcccatgcaaaccgtcccagaggcatcattgttgac
ccctgctacggctacctgtactggactgactggggctatccagctaagattgagagggcc
acactggggggaaacttccagacctccatcatcaacaccagcctgtccacgcccaacggc
ctgtctctggattacgaggagaggatgctctactgggctgactcctcattagacaaaatt
gagagggccactctgactggggagaaccgacaagtgatcgtgcagggggcccagtacccg
tacgccatgaccgtcttcaaacaggatatcttctggaccgactggactgagagagccgtc
tttagggcagggaaggacgatggctctgactttgcagtgctggcccaggacatgcagtac
cgaccaaacgacatccatgtttattccgcgtcgaagcaggagagctgcaacagctcctgt
cagcagttcaacggaggctgcagcaatatctgtgtttctggtccgctgggccctgagtgc
cagtgtcctcatgaggggaagtggtacctggccaacaacggcaaagactgtgtcaaagac
acggggaaacgctgcgagccagatcagttcacctgtctcagcggtgactgcatctcagcg
cgctggaagtgtgacggctacaacgactgctacgataactcagatgagctggagagagtg
tgtggtgagagaagaggtttaatctgactgaaacatgtaacgactgttttctgttgctcc
tcctgctcagccttccacacctgctccgccatggacttcacctgtgacaatggccgctgc
gtgccgatgagctacgcctgtgactacacggacgactgtggtgacaacagtgacgaacga
gggtgccccttccccacctgtaacccctccacagagttcacctgcaccaacgggcgctgc
atcagtgcagcctttgtctgtgacggacacaacgactgccgagacaacaccacctccgac
gagatcaactgccctgacaggacgtgtcctgcagggcagatcaagtgtgaacgcaacaac
atctgcatcgaccctgagaacctgtgtgatggctacaacaactgtggagacaacagcgat
gagaatcctctcttctgcgcgggtcacacatgctctccggatcagttcaggtgcgatgga
gggaagtgtatcccagacttttgggtgtgtgattccgtccgagactgcaatgacgggaca
gatgaacctctctcctgcaaggatcaaatcaaaacatgcggcccaagccagttcacctgt
acaaatggaaactgcatcccccagttattggtctgcgatggcaacaacgactgctgggac
gacagtgacgaggctccagagctgcagtgcggccaacgcacctgcagttcggaccagttc
acctgtctgacctggttccccggctacccgcgctgtgtgccgttaagctttgtgtgtgat
ggggacaaagactgcgccaacgcggccgatgagctccagaactgccccaaccgcacctgc
cacatgaatgagtttgcctgttccaacgggctctgcatcttcctcccctaccactgcgac
cgtgtgaatgactgcggggacggcagtgatgagttgggctgtagctatgacacctgcagc
agcagcgagttcacctgcagtaacggcgcctgcacccccgcctccttcgcctgcgacggg
gagagcgactgcatggacggctcggatgaggccgacagcttgtgcgtcacgacccagccc
acctgtgctcccacgcagtacatgtgcaagtcaggcgagtgtatcgacatcaacaaggtg
tgcaacggacagaaggactgccaggacaacagcgacgagaaaggatgcggaatcaatgag
tgccgtagcccgtcagtccacaagtgtgcgcagctgtgcaccgacaccctcaccgggttc
tactgctcctgcaacgccggctaccgactcatgcccgatggcaaagcgtgcgaggacctc
gatgagtgtaccagcacacccgccgtctgcagccaggtctgcgagaacactgtcgggtcg
taccactgcaaatgtgccccggggtacctccgtgaaccggacggacgcacctgtcgtcag
aacagtggcattgcgccctacctgttgtacagcaaccgctactacatccgaaatataacc
accgatgggtcacatctgagtatcgtcctgcaggggctctccaatgtagtggctttagat
tttgacgaccaagagaagaggctttattggctggacgcggggacggggaagattgagagg
atgcgttttgacgggactgacagggagacgttgaaagacgatgcaagagaagttgaaggc
ctggcgctggactgggtgggcaggaagttgtactgggtggacggttattacggttcggtt
catgtgatggagctggatgggcgctaccagaagagactgctgtcaggagaattcacagaa
ggaaatacaacttatgtcatcagccgacctcgtgctgtggctgttaacccgaaatatgga
tggctgtactggactgactggggtgacacagcatatatcggcagagtcggcatggatgga
agcaacatcagtgccatcatcacaaccaagctggagtggcccaacgctctgaccatcgac
tacaccaccaacaagatcttcttcgctgattcccacctgaactttctggattttgccgac
atggacggcaagaaccgccaccgggccattgctggtacacttcctcatgtctttgctgct
tccctgtttgaggactgggtctactggacggactggaacacacacacagtggagaaggct
cacaagtacacaggagagcagcgcacgaccatgggcaacaacacgcatcggccctatgac
atccgcgtctcccacccctacaggcagcctcgcagtgaaaacccctgctcctcccattac
ctgacctgcagtcacctgtgtctggttgcccccggcggggagagagctacctgccagtgt
ccagatcacttcatcggcctcgctgtgggcttcaagatccagtgtgtcgctgactgctca
agcacgcagttcagatgcggggacaacgagaagtgtgtttctatatggtggaagtgtgac
ggccagtcagattgtggtgacggctcagatgaacctcagacctgcccgccccgtttctgc
cccatcggccagttccagtgtcaggatggaaactgcacctaccccggcttcctctgcgac
ggccactccgactgccctgacagctcagatgaggatgcagctctctgcagtgaccaccga
tgccaggaaaaccagttccagtgtaagaacaagaagtgcatcccagtctcctggcactgc
gacggagtgaatgactgtggggacggcagcgacgaagacgcagacatgtgctcgcagagg
acctgcacaccgggacagttccggtgtgctaacggacgctgtctgccgtccagctacgtg
tgcgacgcccaggacgactgtggggacggatctgatgagccgtatgaaacctgcatgggt
ccggactacaagtgtgatgcggacactgagttctcctgtaagacaaactaccgctgtgtc
cctcagtgggctcgctgcgacggcaccaacgactgcatcgacaacagcgacgagcagggc
tgcgaggaggtgacctgtgatcctctgggagatttccgatgtgacaaccaccgctgtgtc
cccatccgctggcagtgtgacggcagcgacaactgtggggacggctcggatgaaaggaac
tgccagccgaggccttgctctgagagtgagcatcgatgtgacgacggacagtgcatccct
ggaaactgggtctgtgactatgacaacgactgtggggacaattcggatgaacgggactgt
gagtttcagacgtgtcgcccaggatccttccagtgtggctcaggtcactgtgtccccgcc
gcgctgcagtgtgacggccggcccgactgccaggacctgtcggatgagaccagctgtcct
actcgttacccaggaggccgttggtgtcctcagaatgagttccagtgtgcgaaccgtctg
tgtgtgagccagagctgggtgtgtgacggagaagatgactgcggggaccgctccgacgaa
cagctcactttatgcttgagcgtcacctgcgagctgccgttcaggttccgctgtgcaaac
ggctactgcctctactccggcctgatgtgcaaccagaaggacgactgtggggacggcagc
gacgagaaggaagaactctgccgcgagcccacgctgccgccctgcactctggaagagttt
aaatgcaccaacggacactgtgtggccctgccgtacgtctgtgaccacaacgacaactgt
ggggaccgcaccgatgaattaggctgcaattttggccaagatcgcaactgtgatgagaag
ctgtgccagcacgagtgcaccaacctgaacggcaccggcttcatctgctcctgccggccc
ggatacaccgtggacccagtcagcacctacacatgcatggacatcgatgagtgcgaggtg
ttcggcacctgccctcaggtctgtaagaacaccaagggcggctacgactgtgagtgttcc
caaggctaccggaaagtgggcaacggaaacatgtgcgaggctgagggaacgacccccctg
ctgcttcttccggagaacattcgtatccggaggttcaacctgcagacggaggcctaccac
gacttcctccgagaagaggagcacatcatggccctggactacgactgggaccacaacgac
accggactcagtgtggtgtacttcactgtagccggtaaggactctgcagcgggggccatt
aagagagcgtacatcccctcagtggacgatggcagcaacaacatcggtgctgctgtcgac
ctcggcattaaatacatcaccacaccagacggcatcgctgtggactgggtgggcaggaac
ctctactgggcagactccagggtgaagaggttagaggtggccatgttggacggacgctac
agaaaacaactagtcaagactgatctgggacatccgtctgctgtggccgtcaacccacga
ctggggatgttgtactgggcggaccgtggggaagctgccaagatcgagtgctcctggctg
gatgggcaggagaggaaagtcctggtgagcgacggcctgggttggccgactggtctgtca
atcgacttcaccaacggcgacagagtctactggtcggactccaaggagagccgcatagag
tctgttctgccctcaggagagggacgcagaactgccgtctacatcgatgtgaggaacccc
ttcagtgtgagtgtgttcgaggatcacgtttattggagcactcaggagaaaggcgaagtg
tttcggcaggacaaatttggccgcggatcaaaaaccaagctgctgaccgcggggccgtgg
ctgacccaggtctctgtgtaccagcagcagagatacaactcactagatatgaagagtccg
tgtaagggaacctgcagccacctgtgtctgctccggccgggggggtacacctgcgcctgc
ccccaggggaccagcctcatccccggcagccacaccgagtgtgatgcaggttttgatccc
ccgcccaccatgcccccacagtgtcagtgtcaaaatggaggcacctgttactttgatgac
aacaaggctctctgcaaatgtcctccagagtggacgggagattactgccagaaaaacaaa
tatgacgcggtcacatcctcaattggcatagcgatcggggtgacagcattgatcgtggtt
ctgctgggagctctggtctatgctgccaggaagaagtccagcctgttaagccttctgccc
agtatgccctcgatgccgtccatgccctccatgcccaacctgccaagcttcagaaatagt
gcgtctccaaatgcatcgagaacagaggagagtgaagcggggctgaattgtgaagcggtt
ccctgtatgtcggtgtccatgttggaaacagacgtgaagagttttgagaacccggcatat
caagttgaagaacaacctccttccacgagcgcagtggcagctacctccgcaaacgagcgg
aacatgatgaaccctttgtatgtggaggaagttaaagttgtggacgagccctcgagaagt
gcaaacacacccactgtcaacatggagccttttgagaacccgtcattcggctcagacgtg
gaagatatcgacgtcgcttctacccaacaacctgcttccagcatacagcggttggaaccc
attgatgatgagagttttgggtctttccaaaaccccacatacgctgagcaaagaccagat
tcggacatttga

KEGG   Notothenia coriiceps (black rockcod): 104954697
Entry
104954697         CDS       T04920                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104954697
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 104954697
NCBI-ProteinID: XP_010780179
UniProt: A0A6I9NQW0
LinkDB
Position
Unknown
AA seq 249 aa
MRCWCSFLALLPWVLVFLDAQLICWQALLRCHEEPECDLAYSQYLAACEGNIRGTRRQCP
SHCINALIRLNHTRSGPDLETCDCAQDQECVKAKRTIEPCLPKRYPSDGGGIGCMEARQR
CEEDSRCHTSLTAYLSYCGQLFNGRKCSSKCKATIQQMLFIPNGVLLNRCVCDGVERPFC
EVVKENMSKLCAIGDHIVVSDQPDVDDFYEDEDYDPKVDRDEEVGHNSASHGLYSLILLL
VLPLARILY
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagatgttggtgcagtttcctggcacttctcccctgggtgctggtgtttttggacgcc
cagctgatctgctggcaggcgctgcttcggtgccatgaagagcccgagtgcgacctggcc
tacagtcagtacttagcagcgtgtgaggggaacatcagggggacgagaagacaatgtccc
agccactgtatcaacgctttaatccggttaaaccacactcgaagtggtccggatctggag
acgtgtgactgtgcacaggatcaggagtgtgtgaaggccaaacgcaccatagagccgtgt
ttaccgaagagatatccgagcgatggagggggaatcggatgcatggaggctaggcagcgc
tgtgaggaggatagcagatgccacacctctcttacagcttatttatcatattgtggtcag
ctgttcaacggcaggaaatgctcctccaagtgcaaagccaccatccagcagatgctgttc
atcccgaacggcgtgctgctgaaccgctgtgtttgcgatggggtggagaggcctttctgt
gaagtggtgaaggagaacatgagcaaactctgcgccataggagaccacattgttgtttca
gaccagccggatgtggacgacttctacgaggatgaagactatgaccctaaagttgacaga
gacgaggaggtgggtcataactctgcttcacacgggctttacagcctcattctgctcctg
gttcttcctctggcacggatactgtactga

KEGG   Notothenia coriiceps (black rockcod): 104955924
Entry
104955924         CDS       T04920                                 

Gene name
boc
Definition
(RefSeq) brother of CDO
  KO
K20020  brother of CDO
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104955924 (boc)
SSDB
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Ig_C17orf99 Ig_4 Ig_5 Ig_6
Other DBs
NCBI-GeneID: 104955924
NCBI-ProteinID: XP_010781625
UniProt: A0A6I9P2E5
LinkDB
Position
Unknown
AA seq 935 aa
MKNGNSADFPLACVCFSELRDFEPDDQHDIEVDEGNTAVIECHLPESQPKAQVRYSVKQE
WLETSKGNYLIMPSGNLQIANATRDDEGSYKCAAYNPVTQEIKTSSSTDRLRIRRSTSEA
ARIIYPPASRVIMVTKGQRLVLECVASGIPAPHVIWAKDGQELRSHNNTRFLLSNLLIDT
VGEADSGNYICRADNGMGSDSSATVLYEVQVFEPPQVTVELLHQEVVFGEMVRFSCKARG
KPTPSVMWLHNARPLAPSPRHRLTAKTLRVFDVGPQDDGLYQCMAENQVGSSQASTRLIT
VSTGITSRGKLPPIDWPTSPDKVLKEQDPVRPGPSGPGLPLDCSELPGQILPADAPIILS
QPRTGKADYYELTWRPRHERGVPVLEYMVKYRKVGVPLMEWTSSCISGALHKLTLAKLQP
DSLYEVEMAAKNCAGLGQPAMMTFRTGKGRRGQMDPPKTPAVPSPSLSPPEAPDKPTVST
ATETSAYVTWIPRGNRGFPIQSFRVEYKKVKKAGEDWVTAVENIPPSRLSVEITELEKGT
SYKFRVVAVNVIGSSPPSAPSKAYTVVGGRTHERPVDGPYITYNEAINETTIILKWTYTP
VNNTPIYGFYIYYRPTDSDNDSDYKKDVVEGDRYWHSVTDLQPETAYDIKMQSFNEKGES
EFGNVVILETKARPHHHRPSPSESPDHPMGPPSGLVPRPGDLPYLIVGIVLGAFVFIIVA
FIPFCLWRAWAKQKQMSDLCFPAVAAPGLSCQYTMVPLQGLALVGHCPLDSRMTAPHGVY
PANGECIGNGKLHHNTHFLPGLQQDCDMECDTLLPQMGSNGHLPVYHYSNRGPDHHEHGC
CPADDSTLQLLDSSHQPLGSQELGGDGDFYVEDEAEDDVNYKPASFPLLSLEDEGIFTTP
SSAATTPQSQDIQEVNILPNEASPEGEGTANTTDA
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgaagaatggcaacagcgctgacttccccctcgcctgtgtgtgtttttcagagctgcgg
gacttcgagcccgacgaccagcacgacatcgaggtggacgaaggcaacacggcggtcatc
gagtgtcacctccccgagagccagcccaaagcgcaggtccgatacagcgtcaaacaggag
tggctggagacttccaaagggaactacctcatcatgccgtcagggaacctgcagatcgcc
aacgccactcgggacgatgaggggtcgtacaagtgtgccgcctacaaccccgtcactcag
gaaatcaaaacatcgtcgtccaccgaccgcctgcgtatacgccggtccacctccgaagcg
gctcgcatcatttaccccccggcctctcgcgtcatcatggtgaccaaaggccagcggctg
gtgttggagtgtgtggccagcggcatccccgccccgcatgtcatatgggccaaagacggg
caggagctgcgttcccataacaacacgcgcttcctgctcagcaacctgctgatcgacacg
gtgggcgaggccgactcaggcaattacatctgcagagcggacaacggcatgggctccgac
agctctgccacggtgctctacgaagtgcaagtgttcgagcccccccaggtgacggtggag
cttctccatcaggaggtggtgttcggggagatggtgcgtttctcctgcaaggctcgaggt
aaacccaccccctctgtgatgtggcttcacaacgcccggcccctcgccccgtctcctcgc
caccgcctaaccgccaagacgctgcgcgtcttcgacgtgggcccccaggacgacgggctg
taccaatgcatggccgagaaccaggtgggcagctcccaagcctccacccgcctcatcaca
gtatcaaccggaattacatccagggggaagctgccccctatcgactggcctaccagcccc
gataaggtgcttaaagagcaggatcctgtgaggcctgggccttcggggcccgggttgcct
ctcgactgctctgagctgccgggacagatcctcccagccgacgctcccatcatcctcagc
cagccccgcacaggcaaggctgattactacgagctcacctggaggccgaggcacgagaga
ggagtccctgtgctggagtacatggtcaaatacagaaaggtgggagtccctctgatggag
tggacctccagctgtatatcaggcgctctccataagctgactctggccaagctgcagccg
gacagcctgtacgaggtggagatggccgccaaaaactgtgctggtctgggacaacctgcc
atgatgaccttcagaactggcaaaggtcgcagaggtcaaatggaccctccaaaaactcct
gctgtcccttcaccaagcctctctcctcctgaagccccggacaagcccacagtctccact
gcaacggaaacgtcagcgtacgtgacttggattcctcgtggtaaccgcggctttcccatc
cagtcgttccgggtggagtacaagaaggtgaagaaggccggggaggactgggtgactgcg
gtggaaaacatccccccatctcgcctctctgtggagatcacggagctggagaaaggtacc
tcctataagttcagagttgtggcggtgaatgtaatcggttccagtcctcccagtgcgccc
tccaaggcctacacagtggtgggggggaggacccatgaacgccccgttgatggaccctac
atcacatacaatgaagccatcaatgagaccaccatcattctcaagtggacgtacactccc
gtaaacaacacgcccatctacggtttctacatctactaccggccgacggacagcgacaac
gacagcgactacaagaaggacgtggtggagggcgacagatactggcactccgtcaccgac
ctgcagccggagaccgcctacgacatcaagatgcagagcttcaacgagaagggcgagagc
gagttcggcaacgtggtgatcctggagaccaaagctcgtcctcatcaccaccgcccgtcc
ccctcagagtcccccgaccacccgatgggtccccccagcggcctggtgcctcggcccgga
gacctcccctacctcatagtcggtatagtcctgggagccttcgtcttcatcatcgtcgcc
ttcatccccttctgcctctggagggcgtgggccaaacagaagcaaatgtcggacctgtgt
ttccccgcggtggcggcccccgggttgtcctgtcagtacaccatggttcccctgcagggc
ctcgctctggttggccactgccctctggacagtcgcatgaccgcaccacatggggtctac
ccggctaacggggaatgcatcgggaacggcaaacttcaccacaacacacacttcctgcca
ggcctgcagcaggactgtgacatggagtgtgacacgctgttaccacagatggggtccaac
ggacatctgcctgtttaccactactccaacagaggtccagaccatcatgaacatggttgc
tgtcctgcagacgactccactctgcagctcctcgactcttcccatcagcctcttggttct
caggagctgggaggagatggagacttttatgttgaagatgaagcagaggatgacgtcaat
tacaagccagcctccttccctcttctctctctggaagacgaagggattttcaccacgccg
tcttcagcggccacgacaccgcaatcccaggacatacaggaagtgaacatcctcccaaat
gaagcgtcccccgagggcgaagggacagccaacacaacagatgcataa

KEGG   Notothenia coriiceps (black rockcod): 104961149
Entry
104961149         CDS       T04920                                 

Gene name
lrp2
Definition
(RefSeq) low-density lipoprotein receptor-related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104961149 (lrp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104961149 (lrp2)
Membrane trafficking [BR:ncc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    104961149 (lrp2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF EGF_CA Arylesterase SPRY
Other DBs
NCBI-GeneID: 104961149
NCBI-ProteinID: XP_010787683
UniProt: A0A6I9PKU3
LinkDB
Position
Unknown
AA seq 4642 aa
MAGIMIPAVCEQVSCRQEKEQAAQRLTEAQITLCSRNTALEVGIKHWEFLYGLLDKHTRV
LAEKNKHWEVNWPKHENMLNTRIQHRDGVIRGLTEANKTLSRKNTKLEGTEQSWQDQIRQ
RDTAIVPGRTCTSGQLSCSNGACIPGEYRCDRLADCSDGSDERDCHYPECTQLRCANGAC
YNRTGRCDQIVDCRDGSDESNCTQHCNTGLFPCHNGACVPQRYVCDHDDDCGDRSDELNC
TYPTCKGNYFTCPSGRCIHQVWVCDGEDDCEDNADEKGCDNVPQECYPGEWPCPSSGLCI
PMDQLCDGTAHCPEGEDETNSTAGRNCSIWRCASLSCEHRCHGSPDGGTCSCPSGYIVNN
NNSRSCIDFDDCSMWGVCDQLCEDRVGSHRCSCRESYILEQHRHCRADSSTGVPFLIFSN
GRDLLIGDVHGNSMRTLVHSQNRGVAVGVDFHYNLHRIFWTDTIQNKVFSVDMDGSNVQV
VLNVSVDYPENLAVDWVNNKLYVVESSVNRIDMVDFDGSNRVTLITENLGNPRGLAVDPT
VGYMFFSDWEAVNGQPGLERAFMDGTNRYGIIRTKLGWPAGITLDIEEKRVYWVDSRYDY
IETATYDGLHRKTVVHGGAVIPHPFGISLFEHSVYFTDWTKMAVMTANKFSDSSTQVVFN
TSQTPHGVAVIHQLKQPYVANPCSVDRGGCEQICVLSHRSDNGGLGYRCKCRMGYDIHAD
GKRCYRREVLAANRVDGVEDLAYDWISKNLYWTDPRYRSISVMKIADKSRRTIIRNLNNP
RAIVVHPLIGYIFWTDWYRPAKIMRAWADGSHALSIVNTTLGWPNGLAIDWSSMRLYWVD
AFFDKIEHSNFDGRNRISLDRITQISHPFGLTIFEGYAYFTDWRLGGIVRVRKTDGGEMV
IIRRGISHIMHVKSFSSNSQIGSNLCNRQTNPNGDCSHFCFPAPDSQRVCGCPYGMKLLP
NQQTCVEDPSSEPPTLQCGANSFSCGNGKCVPNSYRCDGVDDCHDNSDELNCGINNTTCS
PSAFTCANKHCVPTRWRCDGHNDCSDNSDEVNCPTQVPGTCPANQFTCTNHRCIPHTWRC
DTDNDCGDSSDEADCHLASTCHPGQFQCPDHRCIDPSYVCDGDRDCVDGADEQGCIYNCT
GNEFKCSTGHQCVNSYYRCDGVFDCTDRTDEQGCPTRPPGMCHHEREFQCQSDGSCVPST
WECDGHPDCEDGSDEHQACPPRTCPSSLFRCDNGNCVLRSWICDGDNDCRDLSDEKDCPT
PPFRCPSWQWQCPGHSVCINLTTVCDNTPDCPNGADESPLCNEPLPDQESCSDNNAGCTH
GCIQGPFGAQCTCPVGYQLSNDSKTCEDMDECNPPGLCSQHCFNERGSFRCHCQDGYTLE
VDQRTCKASDSRQAFLLVASRNQIVQDDITAQPNVVRSLVRDGRNIVALDFDSVTDRVYW
SDTSQDRIWSANKNGSDRTVVFDSGVTVTESLAVDWVGRNLYWTDFVLETVEVSKLDGTH
RTVLVSENVTNPRALVVDPRDSSHLMFWTDWGRNPRIERASMDGKLRTVIVSTKLYWPNG
LTIDYPNNLLYFADAYLDFIDYCDFNGNNRKQVLASDLVLQHPHAITIFEDFVYWTDRYI
NRVMRAHKWHGENQTVMLFNLPQPMGLVTVHPARQPAGENHCLRSPCSHICLLSAVGPSY
YSCACPSGWTLAADQITCTRVEDPFLVVVRDSIIYGISLDPDDKTNDAMVPIAGLHNGYD
VDFDDNEETIFWVEHPGEIHRVKSDGTNRTEFAPAAILGSPVGLALDWITENLYYTNPAT
QSIEVLKLRGEVQYRKTLITNNGSPTGAGSPVGIAVDPARGKLYWTDQGTESGIAAKVAS
ADMDGLNPAILFTSNLDHIEFLTLDIKENKLYWAVTSTGMIERGDPDGSNRITIVTGLSH
PWGVAVYQDYLYFTDRNFEVIERVEKSTGANRIVLRDNISGLRVLKVHYREASAGTSNGC
TNNMEACEQLCLPRPQGLFTCACATGFKLNADNRTCTPYQSYVVISTLSAIKGFSLEGAD
HSEAMMPVAGIGRNALHIDVHMASGYIYWCDFSSTVATQNGVRRIKPDGSGLHSVVTSGI
GRNGIRGIAVDWAAGNLYFTNAFLTETYVEVLHLNTTFRRVLLKTQVDMPRHIVVDPRNR
YLFWADYGQNPKIERALLDGTNRTVLVSSGIITPRGLALDWQTGYVYWVDDSLDMIARIN
PQGGETEIVRYGSRYPTPYGIAVFESSIIWVDRNLKKVFQASNQPGSTEQPAVIRDNVNM
LRDVTIFDQRTQPTTAQELNYNPCLEANGGCTHFCFALPGSDKDNQNKKCSCAFGNLAAD
NATCVVSRDDYLIYTTESTVRSLRLDPEDHALPFPVVNVPRTSVALDFDLTDRRVYFTQS
SGAGASKISYISLSSPTTAPVEVASDLGAPDGIAYDWINRRIYYSDYVNQSINSMSVDGA
QRTIVAHVSRPRAIMLDPCRGYMYWTDWGTHAKIERATLGGNFRTEIVNSSLVWPNGLTL
DYEEARLYWADASLQKIERSSLTGSNREVIVSTAIYPFAMTMFGQFIYWTDWNTRSIYRA
NKHDGSDQTVMIQNLPSRPMDLQVLASSKQQQCDSPCQQFNGGCSHICSPGPNGAECQCP
SEGRWYLADNKHCIPDNGTRCQPGQYACMNGRCIRAQWKCDNDNDCGDGSDELERVCGHK
PDFNNFVVPQLLSSFIALSAFHTCEPTVFTCGNGRCVPYHYRCDHYDDCGDNSDEASCLF
KPCDPNTEFDCNNGRCIAKDYVCNGINNCYDNGTSDEQNCPERTCQPEQTKCQSTNICIP
RSYLCDGDNDCGDMSDESPTHCETSTCSQSEFRCSSGRCVPAHWYCDGGADCADGSDEPL
SCITQIRTCNTDQFRCDDGRCIASSWLCDGDNDCGDMSDEDQRHNCGNRTCTSAEFTCVN
NQPPQRKCIPRDWVCDGDADCADALDEHQNCSRRSCGINEFSCNNGLCIRSSYRCDRRND
CGDSSDEQGCTYQPCQQHQFTCQNGRCVSHDFVCDGDNDCGDESDELEHVCRTLAPTCPP
GEFKCDNGHCISLSKVCDRSDDCSDNSDEKGCGVNECTDPSIHHCDHNCTDTPTSFICAC
RPGYRLMSDKKSCDDINECAETPSVCSQVCENTLGSYICKCAPGYLREPDGHTCRQNSNI
SPYLIFSNRYYLRNLSTDGQAYSMMLQGLTSVVALDFDRVEKRLYWIDVSRRVIERMSFN
GSNREVVVNGVLHGEGLAVDWIGRKLYWADSFLDCLKVSELDGRFVKKLAEHCVDANNSY
CFENPRAIVLHPKYGYVYWTDWGDKAFIGRVGMDGTNKAAIITTKIEWPNGVTIDYTNDK
LYWSDAHLSYIEYSDLDGQHRHTVYDGDLPHPFALTVFEDFVYWTDWNTRSVEKGNKYDG
SGRQSLVNTTHRPFDVHVCHPYRQPIGNNPCAVNNGGCSHLCLISHGGREHTCECPDHFL
TVQIGGVTRCLPMCSSTQYRCANNERCIPIWWKCDGQNDCRDGSDEPSTCPARHCRLGQF
QCNDGNCTSPHFLCNSHQDCHDGSDEDPVLCATHQCEAHQWQCANKRCVPESWQCDGEDD
CGDQSDEDPAHCSARTCHPGQFKCRNGRCIPQNWKCDVDDDCGDNSDEPLEECMGPAHRC
DNHTEFDCKTNYRCVPLWSVCNGHNDCRDSSDEQGCDEVTCDANGDFRCDNHRCIPLRWK
CDGDDDCGDNSDELTCAPRTCTESEFRCENLRCIPDRWVCDHDNDCEDNSDERDCELRTC
HPGYFQCGSGHCVAERFKCDGNADCLDYTDEMSCPTRFPNGTYCPHFLFECNNHVCIQPH
WKCDGDNDCGDNSDEELHLCLEITCETPFRFRCDNNRCIYSHELCNSVDDCGDGSDERQE
NCQSPTHGPCTDDEYKCSNGQCIPLQYACDDYDDCGDQSDELGCHHGSGHTCSDNICEHN
CTDLTQGGILCSCRPGYKPRETEKHNCEDVDECEVFGKCPQECKNTKGSYECFCAEGFLS
FGEPRGTECAAQGNPPVLLLPDNVRIRRFNLSSEQYSDYVDNAEHIQALDYLWDPEGQGL
SVVYWTVLGRGSQFGSIKRAYMTTFNDNGNNPVKEVDMNLRYIANPDGIAVDWVGGHIYW
TDSGTNRIEVAKLDGRYRKWLIHTDLDQPAAIVVNPSLGMMYWTDWGRKPRIEAAWMDGQ
HREVLVKEDELGWPTGLALDFLNGNRIYWCDSKENIIESMKPDGSDRKIVISGDIGHPYS
LDVFEGHVYWTTKERGEVWKTNKFGIGHKVKVLTINPWLTQVRIYQQQRHNQSVPNPCKN
VCSHLCLLRPGGYTCACPQGSSPVQFDSNECDAAIEPLVAMPAACRCMNGGTCYTDEGGL
PKCKCLYGYVGSYCEMGKSRGAPGGTAVAVLLAVIIILITGALAVGVFLNYKRTGSFIPS
MPKLPSLSSLVKSGDTGNGVTFRSGDNVDLGPAHIGVSFIDTAMQMDDNFALEAGRQPIT
FENPLYATSPGAPSDPAVIHATQVTVNVSGEQLENKFVNPAYHGDQSAVTVNTTSVNTNP
AQESKWSLFKRKLKPSATFENPSYSEMKDDKPVGSSGDSAAPEPSPFAPPAKPRKRERPS
TFSPTEDSFKDTANLVKEDSDV
NT seq 13929 nt   +upstreamnt  +downstreamnt
atggctggaataatgatcccagcagtgtgtgagcaggtgagctgcagacaggagaaggag
caagccgcccagaggctcacagaggcccagatcacgctgtgcagcagaaatactgcattg
gaagtgggtattaaacactgggagttcctatatggacttctggacaagcatacacgtgtc
ctggcagagaaaaacaagcactgggaggtgaattggcctaaacacgagaatatgttgaat
accaggatccagcacagggacggtgtaatcaggggtctgacagaagccaacaagaccctg
tcgagaaaaaataccaaattggagggaacagagcagagctggcaggatcagatccgccag
agggacactgcaatcgtgcctggaaggacgtgcaccagtggtcagttaagctgtagtaac
ggggcatgcatcccaggagaataccgatgtgaccgtctggcggactgctcagatggatcc
gatgagagagactgccattaccctgagtgcacacagctgaggtgtgctaatggggcctgc
tacaaccggaccgggagatgtgaccagatagttgactgccgggatggctctgacgagtca
aattgcacacagcactgtaatacgggcctgttcccgtgccataacggggcgtgtgttcct
caacgctacgtctgtgaccacgatgatgactgtggagaccgaagtgatgagctaaactgc
acatatcctacatgtaaagggaactacttcacctgccccagtggccgttgtatccaccaa
gtctgggtttgtgatggggaagacgactgtgaggacaatgcagatgaaaaaggatgtgat
aatgtaccgcaggagtgttacccaggtgaatggccctgtccatcgtctggcctgtgtatc
cccatggatcagctgtgtgatgggacggctcactgtccagagggagaggatgaaactaac
agcactgctgggcgcaactgcagtatctggagatgtgcctctctgagctgtgagcatcgt
tgtcatggttcccctgatggaggaacatgttcctgtccttctggatacattgtcaacaac
aacaatagtcgctcatgtatagactttgacgactgttcgatgtggggcgtgtgtgaccaa
ctgtgtgaggaccgagtcggttcccatcgctgcagctgtcgagagagctacatcctggag
cagcacagacactgcagagctgactcctcgactggagtcccgttcttgatattttctaat
ggcagagaccttctaatcggtgacgtccatggcaacagcatgcgcactttggttcattca
cagaacagaggagttgcagtgggagtggatttccattataatctgcacaggatcttctgg
actgataccattcagaataaggtgttttctgtggatatggacggttccaatgtgcaggtg
gttttaaatgtatcggttgactaccccgagaacttggcggtggattgggtgaacaataaa
ctgtatgtggtggagtccagcgtcaacaggattgacatggtggactttgatggcagcaac
cgggtcacactcatcactgaaaacctgggaaaccctagaggactggcggtggaccccact
gtcgggtatatgttcttctctgattgggaggcagtgaatggacaaccaggcctggagcgg
gccttcatggatggcaccaaccgttatgggattattagaaccaaactgggttggccagct
ggcataacactggacattgaagaaaagcgcgtctactgggttgacagtcgctatgactat
attgaaacggcgacatatgatggccttcatcgaaaaacggtggtacatggaggtgctgtg
atcccacacccatttggcatcagtctgtttgaacacagtgtttatttcacggactggacc
aagatggccgtgatgacagccaacaagttctctgacagcagtacccaagttgttttcaat
acatctcagactccacacggagtagccgtcatacatcagctgaaacagccatatgttgct
aacccttgtagtgtagacagaggtggatgtgagcagatctgtgttctgagtcacaggagt
gacaatggaggtcttggttaccgctgcaaatgtcgcatgggctacgacatacatgctgat
ggcaagcggtgttatcgcagggaggtactggcagccaacagagtggatggcgtggaggac
ctggcttacgactggatttcaaagaacctctactggactgacccacgatacaggagcata
tctgtcatgaagatagctgataagtccaggagaaccatcatacgaaacctcaacaaccct
cgggccatagtggttcatcctctcattgggtatattttttggactgactggtaccggcca
gcgaaaatcatgagggcttgggctgacgggtcacatgccttgtctattgtcaacacaact
cttggctggccaaatggcctggctattgactggagctcaatgcgtctgtactgggtggat
gctttctttgacaaaattgagcacagcaactttgacggacggaacaggatttctttggat
cgcataacccagatctcccatccgtttggtctcactatttttgaaggctatgcatatttc
actgactggcgcctgggtggcattgtacgtgtgcgcaagaccgatggtggggagatggtc
ataatcagacgaggaatcagccacataatgcatgtcaagtctttcagctccaactctcag
attggttccaatctctgcaacaggcagacaaatcctaacggagactgcagccacttctgc
ttcccggccccagactctcagagggtgtgtggctgtccgtatggcatgaagcttttgccc
aaccagcagacatgtgtggaagacccttccagtgagccccccacgctgcagtgcggagcc
aactccttctcctgtggcaacggcaaatgcgtaccaaacagctacagatgcgatggtgtt
gatgactgccatgacaacagtgacgaactcaactgtggaattaacaacaccacttgctcc
ccgtctgcattcacatgtgccaataagcactgcgtgcctacgagatggcgctgtgatggg
cacaatgactgctctgataacagcgatgaggtaaactgccctacgcaggtgcccggaaca
tgtcctgctaatcagtttacctgtaccaaccaccgctgcatcccacatacctggaggtgt
gacactgataatgactgtggggacagctcggatgaagcagactgccatctggcaagcacg
tgccatccagggcagtttcagtgtccggaccaccgctgcatagaccccagctacgtctgt
gacggggacagggactgtgtggatggggcggatgagcagggatgcatctacaactgcact
gggaacgagttcaagtgttccactggccaccaatgtgtcaactcctactaccggtgtgat
ggggtctttgactgcactgaccgcacagacgagcaaggctgtcctactaggcctccaggg
atgtgccaccatgagagggagttccagtgtcagtcagacgggagctgtgtgccgtctacc
tgggagtgtgacggtcatccagactgtgaggacggcagcgacgagcaccaggcctgcccc
ccccgcacctgcccctcctcactgttccgctgtgacaacggcaactgtgtgttacgcagc
tggatctgtgatggggacaacgactgcagggacctgagtgatgaaaaagactgtcccacg
ccgcccttccgctgtccgagctggcagtggcagtgccccggccacagtgtgtgcatcaac
ctcaccacagtgtgtgacaacacccccgactgccccaacggtgctgacgagtctcctctc
tgcaatgagcccttgccagatcaggagagctgttctgataacaacgctggctgcacccac
ggttgtatccaagggccttttggggcccagtgcacatgccccgttggttaccagctaagc
aatgactccaaaacctgtgaagatatggatgagtgtaacccccctggactctgcagccag
cactgctttaatgagagaggctctttccgctgccactgccaggatggatacacgctggaa
gtagaccagcgtacctgcaaggcctcagattcacggcaggcgttcctgctagttgccagt
cgaaatcagattgtgcaagatgacataaccgctcagcccaatgtggtccgatcactggtc
cgagatgggcgcaacatcgtggccctagactttgactcagtcactgaccgtgtgtactgg
tcggacaccagccaggacagaatctggagtgctaacaagaacggcagtgacagaactgtg
gtatttgacagtggagtgacagtaacagagagccttgctgtggactgggtgggcaggaac
ctgtactggactgacttcgtcttggagactgttgaagtgtctaaactggatggcacccac
cgcactgtgttagtcagtgaaaatgtcaccaaccctcgagctctggtggtggacccgcgg
gacagctctcacctgatgttctggacagactgggggagaaacccccgcattgagagggcc
agcatggacggcaaattaaggactgttatcgtcagcaccaagctgtactggcccaacggt
ctaaccatagactatccaaacaatctgttgtactttgcagatgcctacttggatttcatt
gattactgcgattttaatggcaacaatagaaaacaagttctggccagtgacctggtactg
caacatccccacgcaattaccatttttgaggattttgtgtattggaccgacagatacatc
aaccgtgtgatgcgagcccataagtggcacggggagaaccagacagtgatgcttttcaac
ctccctcagcccatgggtctggtgacagtgcacccagccaggcagccggcaggtgaaaat
cactgcttgaggagtccctgttctcatatctgcttgctttctgctgtgggaccgagctat
tactcgtgtgcctgcccctcaggctggacactggcagcagaccaaatcacctgcaccaga
gttgaagatcctttcctggtggttgtgcgagacagcatcatctatggcatttccctggac
ccagatgacaagacaaatgatgctatggtccctatcgctgggcttcataatggatacgat
gttgactttgatgacaatgaagagaccatcttctgggtggagcacccgggtgagatccac
agggtgaagtcagatggtaccaacaggacagagttcgcccctgcagccatcctcggctcc
cctgttggcctggccttggactggataacagagaacctgtactataccaacccagctaca
cagtctattgaggttttgaagttgagaggggaggtacagtacaggaaaactctcatcaca
aataacggctctccaactggcgctggcagtcctgttggcatcgcggtggatccagcacgt
ggaaaactgtactggacagaccagggaacagagagcggcatcgctgccaaggtggcgtct
gcagacatggatggcttgaaccctgccatcctgttcaccagcaacctggatcacattgag
ttcctcaccttggacatcaaagagaacaagctgtactgggctgttactagcactggcatg
attgagcgtggggatccagacggaagtaaccgcatcactatagtgaccggcctgtctcac
ccctggggagtggccgtctatcaagactacctctacttcactgaccgcaactttgaggtg
atagagcgcgtggagaagtccacgggtgccaacaggattgtgctgcgagacaacatttct
ggactcagagttctgaaagtgcattatcgtgaggcctctgcgggaacttccaatggctgc
accaacaacatggaagcgtgtgagcagctctgcctgcctcggccgcagggtctgtttacc
tgtgcatgcgccacaggttttaaactcaacgctgacaacaggacctgcactccctaccag
tcctatgtcgtcatctccactctttctgcgatcaaaggcttcagtctggaaggggcagac
cactctgaggccatgatgcctgtggctgggataggccgtaacgctttacacattgatgtt
cacatggcctccggatacatctactggtgtgacttcagcagcactgtggccacacagaac
ggggtcagacggatcaagccagatggctcaggattacatagtgtagtaacatctggaata
ggacgcaacgggatacgaggcattgctgtggactgggctgcagggaatctgtatttcacc
aacgccttcctcactgagacgtatgtggaggtgctccacctgaacaccactttccgcagg
gtgctgctgaagacccaggtggacatgccgcgccacatcgtggtggaccccaggaacaga
tacctgttctgggcggattatggtcagaacccaaaaattgagcgagcactcttggacggc
accaaccgcacagttttagtgtcatcagggattattactcctcgaggtctcgctctggac
tggcagactggctacgtctactgggtagatgactccctggatatgattgcacgaatcaac
cctcaaggaggggagacggagatagtcaggtacggcagccgctaccccactccttatgga
atcgcagtgtttgagagtagtattatctgggtggacagaaacctgaagaaggttttccaa
gcaagcaatcagcccggcagcacagagcagcctgctgtcatcagagacaatgtcaacatg
cttagggacgttacaatctttgaccagcgcactcagcctaccaccgcccaggagcttaac
tacaacccctgcttggaggctaatggaggatgtacccacttctgcttcgccctccccggt
tccgacaaagataaccagaacaaaaagtgcagctgtgcttttgggaatcttgcagccgac
aatgcgacctgtgtggtgtcaagggatgattatctcatctacacgactgagagcactgtg
cgcagcctccgactcgacccggaggaccatgcgctgcccttccctgtggtaaacgtgcca
cgcacctcagtggccctggattttgacctcacagaccgcagggtctacttcacacagagc
tcaggcgcaggagcaagcaagatcagctacatcagcctgtcctctcccaccacagctcct
gtagaggtggcttcagatctgggggctccggatggcattgcttatgattggataaacaga
agaatctactacagtgactatgtcaaccagagcattaactccatgtctgtggatggggct
caaaggactatcgttgcccatgtgtcgaggccaagggccatcatgttagatccctgcagg
ggatacatgtattggacagactggggaacccatgcaaagattgaacgtgcaaccttaggg
ggaaacttccggacagagattgtgaacagcagtcttgtgtggcccaatggactgaccctg
gattatgaagaagcgagactgtattgggccgatgctagcttacagaagattgagagatcc
tctctcacggggtccaatcgggaggtcatcgtcagcacagccatctacccctttgctatg
accatgtttggccagttcatctactggactgactggaacacacgcagcatctatcgggcc
aacaagcacgacggctctgaccagacggtcatgatccagaaccttccatctcggccgatg
gacctccaagttctggccagcagcaagcagcaacagtgtgacagtccatgccagcagttt
aatggaggctgcagccacatctgctcacccggacccaacggagctgagtgtcagtgtcca
tccgagggccgctggtatctggctgacaacaagcactgtatccctgataacgggacgcgc
tgccagccgggtcagtacgcctgtatgaatggccgctgtattcgtgcccagtggaaatgt
gacaacgacaacgactgtggagatggaagcgatgagttggagagagtctgtggacataaa
cctgacttcaacaactttgttgtcccacagctgctgtcatcttttattgccttgtcagcc
ttccacacctgtgagcccacagtgtttacttgtggaaatggccgatgcgtgccgtatcac
taccgctgtgaccactacgacgactgtggagacaatagtgacgaggcgagctgtctgttc
aaaccatgtgaccccaacacagagttcgactgcaacaatggccgctgcattgcaaaggac
tatgtttgtaatgggatcaacaattgctatgacaacggcacctctgatgaacaaaactgc
ccggagagaacctgccagccagagcaaaccaaatgtcagtcgaccaacatctgcatccca
cgctcatacctttgcgatggagacaacgactgtggggatatgagcgacgagagccctaca
cactgtgagacatccacatgttcccagagtgagttccgttgctccagcgggcgctgcgtc
cccgcccactggtactgtgacgggggggctgactgcgccgacggctctgatgaacccctc
tcctgcatcacacagatcagaacctgcaacacagatcagtttcgctgtgatgacggcagg
tgcattgcctcatcctggctctgtgatggggacaatgactgtggagacatgagcgacgaa
gaccagaggcataactgtggcaatcgcacatgtacaagcgcagagttcacctgtgtgaac
aaccaaccccctcagcgtaaatgtatcccacgtgactgggtgtgtgatggagacgcagac
tgtgcagatgctttagatgaacatcagaattgctctcgcagatcctgtggcatcaatgag
ttcagctgtaacaatggcctctgcatacggagctcctacaggtgtgatcgtcgaaatgac
tgcggggacagcagtgacgagcagggctgcacctaccagccgtgccagcagcaccagttc
acctgccagaacggtcgctgcgtgtctcatgactttgtctgcgatggcgacaacgactgc
ggggatgagtctgatgagctggagcacgtgtgccgcacactagcacccacctgcccgcct
ggggagtttaaatgtgacaatggacactgcatctccctgagcaaagtgtgcgacagaagc
gacgactgctccgacaacagcgatgagaagggatgcggtgtcaatgaatgcacagatcca
tccatccatcactgtgaccacaattgcaccgacacacccaccagcttcatctgcgcctgt
cgccccggctaccgcctcatgtctgacaaaaaatcgtgtgacgacatcaacgagtgtgca
gagaccccgagcgtgtgcagccaggtctgtgagaacactctgggctcctacatctgtaag
tgtgctccgggatacctccgagagccggacggccacacctgccgtcagaacagcaacatc
tcgccctaccttatcttcagcaaccgctactacctgaggaacctgtccacggatggacag
gcttactccatgatgctgcagggcctgaccagcgtggtggccttggactttgatcgcgtt
gaaaagcgtctttattggattgacgtcagccgcagagtgattgagaggatgtccttcaat
ggcagcaacagagaggtggtggtcaatggagttctgcatggggagggcctcgcagtggac
tggataggcagaaaactctactgggccgacagcttcctggattgtcttaaagtatctgaa
ctggatggtcgatttgtgaagaaactggcagagcactgcgttgatgccaataacagttac
tgctttgaaaacccccgggccattgtgttgcatcccaaatatggatatgtatactggaca
gactggggagacaaagcctttataggtagagttggaatggatggaaccaacaaagcggcc
atcatcaccaccaagatcgagtggcccaacggggtcacgatcgactacactaatgacaag
ctctactggtctgatgcccatctcagctacatcgaatactcagacttggatggtcaacac
agacacacagtgtacgatggagatttgcctcacccgttcgccctgactgtgttcgaggac
tttgtttactggactgactggaacacacgctcagtggagaaaggaaacaaatacgatggc
tctgggcgtcagtccctggtcaacaccactcacagaccattcgacgtccatgtgtgtcat
ccttacagacagcccattggaaacaatccctgtgcggtgaacaatggaggctgctctcac
ctgtgtctgatcagccatggggggcgggaacacacctgtgagtgccccgaccatttcctg
actgtccaaataggaggtgtgacgcgatgccttcccatgtgcagcagcacccagtaccga
tgtgctaacaatgaacggtgtattcctatctggtggaaatgtgacggtcagaatgactgc
agagacggctccgacgagccctccacctgcccggcgcgccactgcaggctcggacagttt
cagtgcaacgatggaaactgcaccagcccccacttcctgtgcaacagccaccaggactgc
catgacggctccgatgaagaccctgtgctgtgtgctacacaccagtgtgaagcccaccag
tggcagtgtgcgaataagcggtgtgtccccgagtcatggcagtgtgacggcgaggacgac
tgcggggatcagtctgacgaagaccccgcccattgctccgccaggacctgtcaccccgga
cagttcaagtgccgcaacggacgctgtatcccacaaaactggaaatgtgatgtagatgat
gactgtggtgacaactctgatgaaccgttagaggagtgcatgggaccggcacatcgatgt
gacaaccacacagagtttgactgcaagaccaactaccgctgtgtgccactatggtctgtt
tgcaacggccacaatgactgcagagacagcagcgatgagcagggctgtgatgaagtgaca
tgtgacgctaacggagatttccgctgtgacaaccaccgctgcatccctctgagatggaaa
tgtgacggagatgacgactgcggggacaactctgatgaactcacctgtgctccacgcaca
tgcacagagagcgagtttcgttgtgaaaatctgcgctgcattcccgaccgttgggtctgt
gaccatgacaacgactgtgaggacaactcggatgaaagggactgtgagttgaggacgtgt
catcccggttacttccagtgtggcagtggacactgtgtcgctgaacgctttaaatgtgac
ggcaacgccgactgtctcgactatacagatgagatgtcttgtcctacacgctttcccaac
ggaacatactgcccccacttcctgtttgagtgcaataaccacgtgtgcatccagcctcat
tggaaatgtgacggagacaacgactgtggagataattcagatgaggagcttcacctctgc
ttggaaatcacatgtgagactccgttccgtttccgctgcgacaacaaccgctgcatctac
agccacgagctgtgcaactctgtggacgactgtggagacggctccgatgagagacaggaa
aactgccaaagtcccactcatggaccgtgtacagatgatgagtataaatgcagtaacgga
cagtgcatccctctgcagtacgcctgtgatgattatgacgactgtggagaccagtcggat
gagcttggctgccatcatggcagtggacacacatgcagtgacaacatctgtgaacacaac
tgcaccgacctgacgcagggaggcatcctgtgttcctgccggcccggctacaagcccaga
gagacagaaaagcacaattgtgaagacgtggatgagtgtgaggtgtttggcaagtgtcct
caggagtgcaagaacacgaagggcagctacgagtgtttttgtgctgagggctttctttct
tttggggagccgcgtgggacagagtgcgctgcccagggaaaccccccggtgctgctgttg
ccagacaacgttcgcatccggcgtttcaacctgtcctctgagcagtattcagactacgtg
gacaatgctgagcacatccaagctttagactacctgtgggatccagagggacaaggactc
agtgttgtgtactggacagtgttgggtcgggggtctcagtttggctctatcaaacgcgcc
tacatgaccacatttaacgataacggcaacaacccggtgaaggaggtggatatgaacctg
agatacatcgccaatcctgacggcatcgctgtggactgggttggcgggcacatttactgg
acagattcaggcaccaatcgaattgaagtggccaaactggatgggcgttacaggaagtgg
ctgatccacacagacctggaccagcccgctgctattgttgtcaatccatcactggggatg
atgtactggacagactggggcaggaaacccagaatagaagcagcgtggatggacggtcag
cacagagaggtgctggtgaaggaggacgagctgggatggcctaccggtctggctctagac
tttctgaatgggaacaggatctactggtgtgactccaaggaaaacatcattgagtccatg
aagcctgacggcagtgacaggaagatcgtcatatcaggagacattggacatccctacagc
ctggatgtgtttgagggtcatgtgtactggacaacaaaagagagaggtgaagtgtggaag
accaacaagtttgggataggacacaaagtcaaggttctaaccatcaacccatggctgact
caagtccgcatctaccagcagcaacgacacaaccagtcagtacccaacccttgtaagaat
gtgtgcagccacctgtgtctcctgcggccgggggggtacacctgcgcctgccctcagggc
tcctctcctgtgcagtttgactccaatgaatgtgacgcagccattgagccactcgttgca
atgcccgctgcatgtagatgcatgaatggtggaacctgctacactgatgaaggcggtctg
cccaagtgcaaatgtctgtacggttatgtgggcagctactgcgagatggggaagtcgagg
ggcgctccaggaggaacagctgtggctgttctcctggcagtcatcatcatcctgatcact
ggagctctggctgtcggtgttttcctcaactacaaacgaacaggatcgttcatcccctcc
atgcccaaactacccagcctcagcagcttggtgaagtccggtgacactgggaacggggtg
acgtttcgctccggtgataatgttgatctgggaccggcacacattggagtgtcattcatt
gacacagccatgcagatggatgataatttcgccctggaagctgggaggcagccaatcacg
tttgagaacccgttatacgcaacatctcctggagcgcccagtgatcctgcagtcatccac
gccacacaggtgacagttaatgtgagtggtgaacagttggagaacaagtttgtgaacccg
gcatatcacggagatcagagtgcagtcactgtgaacacaacttctgtcaacaccaatcct
gctcaggagtcgaagtggagcttattcaagcgaaaattaaagccaagcgccacgtttgaa
aacccttcatattcagagatgaaggatgacaagccagtaggaagcagcggggactctgcg
gcccccgagccctctccgtttgccccccccgccaaacctcggaagagggaacgtccgagc
accttttctccaaccgaggacagtttcaaagacacagccaacctcgtgaaagaggacagc
gacgtataa

DBGET integrated database retrieval system