KEGG   Notothenia coriiceps (black rockcod): 104944418
Entry
104944418         CDS       T04920                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: speckle-type POZ protein-like A
  KO
K10523  speckle-type POZ protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104944418
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ncc04121]
    104944418
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     104944418
SSDB
Motif
Pfam: BTB MATH BTB_2
Other DBs
NCBI-GeneID: 104944418
NCBI-ProteinID: XP_010768247
UniProt: A0A6I9MV36
LinkDB
Position
Unknown
AA seq 392 aa
MSRVPTPPPPGEMSSGPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQSNMNMLK
VPECQLSDDLGNLWECSRFTDCSLYVGGQEFKAHKSILAARSPVFNAMFEHEMEESKKNR
VDISDVDPDVFKEMMGFIYTGKAPNLEKMADNLLAAADKYALERLKVMCEEALCNSLSVE
NVADTLILADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNHATDIMETAGWKSMI
QSHPHLVAEAFRALASAQCPPFGLPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcacgggttcccacccctccccctcctggggagatgtcaagtggacctgtggcagag
agctggtgttacacacaggtcaaagtggtgaagttttcgtacatgtggaccataaacaac
tttagtttttgcagagaagaaatgggggaggtgttgaagagctccaccttctcctctggc
ccaaatgacaagatgaaatggtgtctgcgagtcaatcccaagggactcgatgatgagagc
aaagattatctgtcactgtatttactccttgttagttgtccaaaaagtgaagtcagagca
aagttcaagttttcgttgttgaacgctaaaagagaagagacaaaagcaatggaaagccaa
agagcatatagatttgtccaaggcaaagactggggtttcaaaaaatttattaggagagat
tttctccttgatgaagccaatggcctcttaccggatgacaagctcaccctcttctgtgag
gtaagcgttgtccaggactctgttaacatttcgggccagtccaacatgaacatgctgaag
gtaccggagtgtcagctgtctgatgacctggggaacctgtgggagtgttcacgcttcacg
gactgcagcctctatgtgggggggcaggagttcaaagcccacaaatccatcctcgcagcg
aggtcacctgtcttcaatgctatgttcgaacatgaaatggaggagagtaaaaagaaccgt
gttgacatcagtgacgtagacccggatgtctttaaggaaatgatgggcttcatctataca
ggaaaggcccccaacctggagaagatggcagacaatttgctggcagctgcagataaatac
gctctggagcgtttaaaggtcatgtgtgaggaggccttgtgcaacagcctttcagtggag
aacgtggccgacaccctcatcctcgcagacttgcacagtgccgagcagctcaaagcacaa
gccatagattttatcaacaggtgcagtgtcctgagacagctgggctgtaaagatggaaag
aactggaatagcaatcatgctacagacataatggagactgcaggctggaagtcaatgatc
caatcccacccccacttggtagccgaggccttccgcgccctggcttcagcacagtgccca
ccctttggtcttcccaggaaacgcctaaaacagtcctga

KEGG   Notothenia coriiceps (black rockcod): 104946769
Entry
104946769         CDS       T04920                                 

Gene name
spop
Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104946769 (spop)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ncc04121]
    104946769 (spop)
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     104946769 (spop)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 104946769
NCBI-ProteinID: XP_010770952
UniProt: A0A6I9N2Y4
LinkDB
Position
Unknown
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKAEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPDCRLADELGGLWENSRFTDCSLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTDKAPNLDKMADDLLAAADKYALERLKVMCEDALCTSLSVE
NAAEILILADLHSADQLKTQAVDFINYHAAEVMETAGWKSMVASHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagagtcccgagtccccctccccctgcggaaatgtccagcgggcccgtggccgag
agctggtgttacacacagatcaaagtggtgaagttctcttacatgtggaccatcaacaac
ttcagcttctgtcgtgaggagatgggagaggtcatcaagagctccaccttctcttctggg
gccaacgacaagctgaaatggtgtttgcgagtgaatccgaagggcctggacgaggagagc
aaagactacctgtctctctacctgctgctggtcagctgtccgaaggcagaggtgcgcgcc
aagttcaaattctccatcctcaacgccaagggagaggagaccaaagccatggaaagccag
agggcatatcgctttgtccaggggaaagactggggcttcaaaaagttcatccgcagagac
ttcctcctagatgaggccaacggtcttctacctgacgacaagctcacgctcttctgcgag
gtaagcgtggtgcaggactcggtgaacatatctgggcagaacacgatgaacatggtgaag
gttcctgactgccggctagcggacgagctggggggattgtgggaaaactcccgcttcaca
gactgctccctgtgtgtggcaggacaggagtttcaggctcacaaagccatcctcgcagca
cgttcccctgtattcagcgccatgtttgagcacgagatggaggaaagcaaaaagaaccgt
gtggagatcaacgatgtggagccggaggttttcaaagagatgatgtgcttcatttacaca
gacaaagctcccaacctggacaagatggctgacgacttgctggcagcggctgacaagtat
gctctggagagactgaaggtcatgtgtgaagacgcgctgtgcaccagtctgtctgtggag
aacgcagcggagatcctcatcctggcggacctgcacagcgccgaccagctgaaaactcag
gccgtcgacttcatcaactaccacgctgcggaggtgatggagacggcggggtggaagtcc
atggtggcgtctcaccctcacctggtggccgaggcgtaccgctccctggcctcggcgcag
tgccccttcctcggacccccccgcaagcgcctcaaacaatcctaa

DBGET integrated database retrieval system