KEGG   Notothenia coriiceps (black rockcod): 104944878Help
Entry
104944878         CDS       T04920                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04210  Apoptosis
ncc04625  C-type lectin receptor signaling pathway
ncc04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104944878
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104944878
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104944878
   04672 Intestinal immune network for IgA production
    104944878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104944878
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     104944878
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: STE group
  Other
   104944878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 104944878
NCBI-ProteinID: XP_010768767
LinkDB All DBs
Position
Unknown
AA seq 845 aa AA seqDB search
MAVRQRIFNSTSPFSGSSQAELKGSYPSCSAAEQEAEEEEEEGKDSKTGYTARLNPLIKK
LLTHGTAEQVGEKPLKTSTFIAQAECETQDSQEFSPSCYERSYVPSPNCFISSVTSEHNN
VATTASSIQEPNRSSAQLVPRKRARKRQKRKGKKKLERKKERQRHRHRMPSGVPEQESGS
FLVRILEESSCCSSVESSEERDGGPPLYSRQIYNTHSSCSPPTWGEPVCVSLSSVHSYGQ
DSDSDSLSSLGDCSLAVAGLRGCVSQGDRCYAGPFFKDVERGVREEEDELSADDSVTTEG
MIFDNENIQPVDSEYKEGREYVLPQFIKEGSYGEVHSAQDVNTGFKFAVKKIALKRFSSE
EVGAWSTLRSPRVVELFGVVREGPNVMLFMDLKSGSLGQLISERGRLPEDLSLHYNGQIL
TALEYLGKKKVAHLDIKADNVLLSEDGRDTFLCDFGHAERLDNQGQSLSGSKDLKGTETH
MAPEIVKGEPRGAKADVWSSCCMLLHMLNGCQPWSRYYTCRLYLKIANEPPPVREIPPDC
SPLTAEVIKAGLQKDPAKRASASELKEKTARALTEVGGLTSPVRGPYTDPLCVSDKPPDS
LQLINSSVNYEDEDQESVEKLIPTGRRTKDRSDDDEEEWNQDSISCPQTLICEPKYKRGN
KISTVPELELRKLERDFYLSSLSQLHSVEMQEQLLSCLSSDLYSTWEPWDKKDSGRWSLS
PADDLSSGVFSYSSQPDVQVSSLDLLGHTQLPPPCCFEGVDVCIREFSGRSIRIRETRRV
KVGHIATGISDQMSERVFTLETQQGQQVAHDEEVQESGLELSCVPAPDFSSAWRWRIRDG
VLETR
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaggcaaaggatttttaactcgacatcacctttctccgggtcgtcccaagct
gagctgaaggggtcgtacccgtcctgctccgctgcagagcaggaggcagaggaggaggaa
gaggaggggaaggacagcaaaacgggctacacagcccgtttgaaccctttgataaagaaa
ctcctgacacatgggaccgcagagcaagtgggcgaaaagcccctgaagacctccaccttt
attgcccaagctgaatgtgaaacccaggattcccaagagtttagtccatcctgctatgaa
cgctcctatgtcccctccccgaactgcttcatcagcagtgttacctcagagcacaacaac
gtggcgaccacggcctcctccatccaggagccgaaccgctcgtccgctcagctcgtgcca
agaaagagggcgaggaagagacagaagcgaaaggggaagaagaaactggagaggaagaaa
gagaggcagagacacagacatcgaatgccctctggagtccctgagcaggagagtggaagt
tttctggtccggatcctggaggagtcttcctgttgcagcagcgttgaaagctcagaagag
cgggacggagggccccctctctacagccgacagatctacaacacacactccagctgctct
cctccgacctggggggagccggtgtgcgtctccctctccagtgtccactcctacgggcag
gacagcgactcagactccctcagcagtttgggagactgttccctggctgtcgctggcctc
agaggctgcgtcagtcagggggaccggtgctacgcagggcccttcttcaaagatgtggag
cggggcgtaagagaggaggaggatgagctctcagcagatgattctgtcaccactgaggga
atgatctttgacaatgaaaacatccagcctgtggactctgaatacaaggaggggagggag
tatgtcctcccacagttcatcaaggaaggctcctatggtgaagtacacagcgcacaagat
gtcaacacaggcttcaaatttgctgtcaaaaagatcgccctgaagaggttcagcagtgag
gaggtgggtgcgtggagtaccctcagatctcctcgtgtggtggaactctttggagtggtc
agagaggggccgaacgtcatgctcttcatggacctgaaatctggctcgctgggccagctg
atatcggagcgtggccggctgccagaggacctgagcctccactacaatggacaaatccta
acagcactggagtacttggggaagaaaaaagtagcgcatctagatatcaaagctgacaat
gtgttgctgtcggaggacggcagagacaccttcctgtgtgattttggacacgcagagaga
ctggacaatcagggacagagcctcagcgggtccaaagatctgaagggcacagagacccac
atggcccctgagattgtgaaaggtgaaccccgcggagccaaagcagatgtgtggagcagc
tgctgtatgttactgcacatgctcaatgggtgccagccttggagcagatactacacctgt
agactttacctgaagatcgctaacgagcccccgcccgtgagagagatcccccccgactgt
agcccgctcacagctgaagttatcaaggcggggctacagaaggatccagccaagagagca
tcagcatctgagctcaaagagaaaactgccagagctctgacagaagttggaggactcacc
agcccagtgaggggcccctacacagaccccctgtgtgtctctgacaaacctcctgactcc
ctgcagctgatcaacagcagcgtaaactacgaggatgaggatcaagagtctgttgagaaa
ctgatcccaacagggaggaggacaaaggaccggagtgatgatgatgaagaagagtggaat
caagactctatttcctgtccacaaacactgatctgtgagccaaaatacaagaggggcaac
aagatctccactgtgcctgaacttgagctccgtaaactggagcgagacttttacctgagc
agtctgtcccagctccactcggttgagatgcaggagcagctgttgtcttgtctcagcagc
gacctgtactccacctgggaaccatgggacaaaaaggactctggccggtggtctctgagc
ccagcagacgacctcagctccggtgtgttctcctacagcagtcagccagacgtgcaggtt
tccagtttggatttgctgggtcacacacaactaccaccaccctgctgttttgaaggggtg
gatgtctgcatcagagaattcagtgggagaagcatccgcatcagagagacgcgccgtgtg
aaggtgggccacatcgccacgggaatcagtgatcagatgtccgagagggttttcaccctg
gaaacccagcagggccagcaggttgctcacgatgaggaggtgcaggagtccggtctggag
ctcagctgtgttcctgctccggacttcagctctgcctggaggtggaggatcagagacgga
gtgctggagacgagatag

DBGET integrated database retrieval system