KEGG   Notothenia coriiceps (black rockcod): 104945106
Entry
104945106         CDS       T04920                                 

Gene name
ttk
Definition
(RefSeq) dual specificity protein kinase TTK
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104945106 (ttk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104945106 (ttk)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ncc03036]
    104945106 (ttk)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     104945106 (ttk)
Protein kinases [BR:ncc01001]
 Serine/threonine kinases: Other
  TTK family
   104945106 (ttk)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     104945106 (ttk)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 RIO1
Other DBs
NCBI-GeneID: 104945106
NCBI-ProteinID: XP_010769029
UniProt: A0A6I9MS78
LinkDB
Position
Unknown
AA seq 440 aa
MPRLSQQSSVGARQGVEACHPSPTRRASLQVEAVIEDPEEAQDNFIVARSNCKGFAFVHV
AHAQFELSQGNVIKATSILHKAQALNARPAELLEGAVRNLKAGEKLLMPNREEEHSTDLQ
VGASVFSFGRNPEPYLPARVPVSRSVEQPKAASREPLSELKIPTSLSRHISPEDKQTTPP
DPRPIPRVVESLPTPSFHLPSRPNRQTVCQTPNGYRNPSANSFITPVVKRVAEMPSSALA
AHRVAPPQQPCAPLSHASGFQTPQASLSVLLNETITIKGKQFIILKMIGRGGSSKVYQVL
DDKNQLFAVKYVDLEEADAQTVESYKNEIQHLNHLQLYSDQIIKLYDYEITNSYIYMLME
CGNLDLNTWLRNHKTVNPLDRKFYWRNMLEAVHAIHSQGIIHSDLKPANFVLVNGSVKLI
DFGIANTIQPDVTSIMKDSQ
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgccccgtctgtcccagcagtcctccgtcggagcgcgtcaaggggtagaagcatgccac
cctagcccgactcgcagagccagcctccaggtagaagctgtgattgaagaccctgaagaa
gctcaggataatttcatagttgcaagatccaactgtaaaggctttgccttcgtccacgta
gcacatgctcagtttgagctttcgcaaggtaatgtgatcaaggcaacttcaattctgcac
aaagcccaggcgttaaacgccaggccagcagagctgctggagggggccgtacgtaacctg
aaagctggagagaaactgctcatgcccaacagagaggaggaacattccacagatttgcaa
gtaggtgcaagtgtgttttcttttgggagaaacccggagccttatcttcctgctcgggtc
cctgtgagccgctcagtggaacagcccaaagctgccagcagggagcctctatcggagttg
aagattccaacatccctcagccgacacatttccccagaggataaacaaacaacacctccg
gaccccagacctattccacgtgttgttgagtctctccccactccatccttccatctaccg
tccagaccgaaccgacagacagtctgtcagactccaaacggctacagaaacccctctgct
aacagcttcatcactcctgttgtgaagagagttgctgaaatgccttcctcggcattggca
gcgcacagagttgcaccccctcagcagccgtgcgcaccgctgagccatgcatcaggcttc
cagaccccacaggcttctctctctgtgttgttgaatgaaaccatcaccattaagggcaaa
cagttcattattctcaagatgataggacgtggcgggtccagcaaggtctaccaggtcctg
gatgacaaaaatcagctgtttgccgtgaaatacgtcgacctggaggaagctgacgctcag
acggtagagagctacaaaaatgagattcagcatctgaaccacctgcagctgtacagcgat
caaattatcaagctctacgactatgaaataacaaacagctacatctacatgctgatggag
tgtgggaacttggatctgaacacttggctgaggaaccacaaaactgtgaatccactggac
aggaagttctactggaggaacatgctggaggccgtccacgccatccacagccaaggaatc
atccacagtgacttaaagccagcaaactttgttcttgtgaacggttcggtgaagttgatt
gactttggcatcgcaaacacaatccaaccagacgtgacgagcattatgaaggattcacag

DBGET integrated database retrieval system