KEGG   Notothenia coriiceps (black rockcod): 104945430
Entry
104945430         CDS       T04920                                 

Gene name
tp53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04110  Cell cycle
ncc04115  p53 signaling pathway
ncc04137  Mitophagy - animal
ncc04210  Apoptosis
ncc04216  Ferroptosis
ncc04218  Cellular senescence
ncc04310  Wnt signaling pathway
ncc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104945430 (tp53)
   04310 Wnt signaling pathway
    104945430 (tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    104945430 (tp53)
  09143 Cell growth and death
   04110 Cell cycle
    104945430 (tp53)
   04210 Apoptosis
    104945430 (tp53)
   04216 Ferroptosis
    104945430 (tp53)
   04115 p53 signaling pathway
    104945430 (tp53)
   04218 Cellular senescence
    104945430 (tp53)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104945430 (tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104945430 (tp53)
   03036 Chromosome and associated proteins [BR:ncc03036]
    104945430 (tp53)
   03400 DNA repair and recombination proteins [BR:ncc03400]
    104945430 (tp53)
Transcription factors [BR:ncc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    104945430 (tp53)
Chromosome and associated proteins [BR:ncc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104945430 (tp53)
DNA repair and recombination proteins [BR:ncc03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    104945430 (tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD YtkA AP3D1
Other DBs
NCBI-GeneID: 104945430
NCBI-ProteinID: XP_010769394
UniProt: A0A6I9MTG8
LinkDB
Position
Unknown
AA seq 377 aa
MTMEEQSLDDLTLSQTMQLSQDSFSELWNTVSAPPLSYLAPTPEETWRTDGHNMDMLLLN
DHSLTEVFDEELFELPPPDMSTMDGVNPTSSTVPVTSDHPGEYGFQLQFQKTGTAKSVTS
TYSEQLNKLYCQLAKTTPVEVLLGKEIPLGAIIRATAVYKKTEHVAEVVRRCPHHQNEDA
ADHRSHLIRVEGSQRAQYFEDPNTKRQSVTVPYELPQLGSEITTILLSFMCNSSCMGGMN
RRPILTILTLETAEGLVLGRRCLEVRICACPGRDRKTDEESSTKMQSGTKQTKKRKSTPG
SSSMKKSRPTSSADEDDKDAFVLNVRGRERYEMLKKINDGLELLDKDRKPETRVKHEFAP
PPSGKRPLHRGDKSDSD
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgacgatggaagagcaaagtctggacgatctgacattgagccaaaccatgcagctgagc
caggactccttcagtgagctgtggaacactgtttcagctccccccctctcatatctggcc
ccaacgcctgaggaaacatggagaacagatggccacaacatggatatgctgttacttaat
gatcattctctgactgaggtttttgatgaggagctattcgagctgcctcctccagacatg
tccaccatggatggggtgaatccgacttcctccacagtcccggtgacttcggaccatccg
ggggaatatggattccagcttcaattccagaagactggcacagctaaatctgtcacttcg
acttattcggagcagctcaacaaactgtactgccagctagccaagaccaccccagtggaa
gttttgttggggaaggagattcctttaggggccatcatcagggctacggcagtttataaa
aaaacggagcatgtggcagaagtggtacgcagatgtccccatcaccagaacgaggacgct
gccgaccaccgcagccacctgatcagggttgagggcagccaaagggcccagtactttgag
gaccctaacaccaagaggcagagtgtgactgtcccctacgagctccctcagttgggctca
gagataacaactattttgctgagcttcatgtgcaacagctcttgcatggggggcatgaac
aggcgccccatcctcaccatcctgaccctggagactgcagaggggctcgttttggggcgg
aggtgcttagaggttcgcatctgtgcttgtccaggcagggaccgcaaaaccgatgaggag
agcagcaccaagatgcagagtgggaccaagcaaactaaaaagcgcaagagcacccccggc
tccagttctatgaagaagtccaggcccacctccagtgcagatgaggacgacaaggatgcg
tttgttctgaatgttcgtggtcgcgagcgctacgagatgctgaagaaaatcaacgatggt
ctggagttgctggacaaagacaggaaacctgagaccagggtgaaacacgagtttgctccg
cctcccagcggaaagagaccccttcacagaggagacaagagtgacagcgactaa

DBGET integrated database retrieval system