KEGG   Notothenia coriiceps (black rockcod): 104946298
Entry
104946298         CDS       T04920                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104946298 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ncc04052]
    104946298 (epo)
Cytokines and growth factors [BR:ncc04052]
 Cytokines
  CSF and other factors
   104946298 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 104946298
NCBI-ProteinID: XP_010770388
UniProt: A0A6I9N4J6
LinkDB
Position
Unknown
AA seq 185 aa
MLQKTGRGLLTLLLLVMEWTRPGLSSPLRPICDLRVLDHFIKEARDAEVAMKSCREGCSL
SESVSVPQTTVDFDVWEEKNGLDQAHEVQSGLCLLQQALGLLKTSVTNTALHSHLDNCIR
NLLSINAVLRSLNIQEYTPPASAAELEGTWRVSSATDLLQVHVNFLRGKVRLLLMDAQAC
QQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcagaaaacgggtagaggactgctcaccttgctgttgttagtgatggagtggacc
cggcctggcctatcatccccgctgaggccaatctgtgacctgagggtcctggaccatttc
atcaaagaagcacgagacgcagaagtcgctatgaagtcgtgcagagaaggatgcagcctg
tcagaatctgtctctgttccccaaaccacagtcgactttgatgtctgggaggagaaaaat
ggattagatcaagcccacgaggtgcagtctggcttgtgcctcttacaacaggccctgggg
ttgctaaagacgtcagtcaccaacacagctctgcacagccacttagataactgcatcaga
aacctgctcagcatcaatgctgtgctgcgcagcctcaacatccaggagtataccccacca
gcaagtgcagcggagcttgaaggaacatggagggtgtcctcggcaacagatttgcttcaa
gttcacgtcaacttcctgcgtggcaaagtgcgcctccttctcatggatgcacaggcctgc
cagcaagacgtcagctga

DBGET integrated database retrieval system