KEGG   Notothenia coriiceps (black rockcod): 104946401
Entry
104946401         CDS       T04920                                 

Definition
(RefSeq) disabled homolog 1-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04068  FoxO signaling pathway
ncc04217  Necroptosis
ncc04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104946401
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104946401
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104946401
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ncc03000]
    104946401
Transcription factors [BR:ncc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    104946401
SSDB
Motif
Pfam: STAT_bind
Other DBs
NCBI-GeneID: 104946401
NCBI-ProteinID: XP_010770536
UniProt: A0A6I9N850
LinkDB
Position
Unknown
AA seq 442 aa
MNMEESNNGSLSAEFKHLTLREQRCGNGGRTNSDASLIVTEELHLITFETEVYHQGLKID
LETHSLPVVVISNICQMPNAWASILWYNMLTNHPKNVNFYTKPPVGTWDQVAEVLSWQFS
STTKRGLTIEQLTTLAEKLLGEPCLKAVLHDHDRSGISSLMRDESDPRALAYVYQHQDTY
CLFYIKTANLADPVLVDIEKVSKMVDQETTEEPADALTQTNSLLLLNDSSAPAAEELALE
EVLSPRKDSSPGNLDQASSSNELMAVFSIQMEEPLMPDQSSCASQPESPHHTLSSSQILS
MFPTQPAGGTPYSSPPYSPISMPWGQQGLLGNQWAGPAAVPWPTMPSSPSAWPPAGYQGP
PAGYPGPPAGYQGPPAGYPGPPAGGQFLSHGPQPGAVMGGNSPASPTAVSGYPSPLNSLY
TPTGATAPLQSVTPTLYQNLLL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaacatggaagagtccaacaatggcagcctgtcagcagagtttaaacacttgaccctg
agagagcagagatgtggtaatggtggccggaccaatagcgacgcctctctgatcgtcact
gaggagctccatcttatcacttttgagacggaagtctaccatcaaggcctgaagatcgat
ctggagactcattccctgcctgtggtagtcatttccaacatctgccagatgcccaacgcc
tgggcctccatcctgtggtacaacatgctcaccaaccacccgaagaacgtgaacttctac
accaagcctccggtggggacgtgggatcaggtggccgaggtgctcagctggcagttctcc
tccaccaccaagaggggcctgaccatcgagcagctcaccacgctggctgagaaattacta
ggtgagccatgcctaaaagctgtacttcatgaccacgaccgaagcgggatcagctctctg
atgagagacgagtctgaccccagagctctggcctacgtctaccaacaccaagacacatac
tgcctcttctacatcaagacggcaaacctggcagacccggtcctggttgacattgagaaa
gtttctaagatggtggaccaggagacaactgaggaaccagcagatgcactgacacaaact
aattccttactgctactaaatgacagttcagccccagcagctgaggaactagctttggag
gaagtgctcagtccacggaaagattcttcccctggaaacttagaccaggcctcttccagt
aacgagctgatggcggttttctcgatccaaatggaggagccgctgatgcccgaccagagc
tcctgcgccagtcagccagagtctccacatcatactctctcctcctctcagatcctctcc
atgttccccactcagccagcagggggcactccttactcctcgcccccatactctcccatc
tccatgccctggggccagcaggggcttctgggtaatcagtgggcaggtccagctgcagtg
ccctggcccacaatgcccagtagtccgtcagcatggccccctgcaggataccaagggccc
ccagcaggatacccagggccccctgcaggataccaagggcccccggcaggatacccaggg
ccccctgcaggaggccagtttctgtcacatggccctcagccaggagctgtgatgggagga
aactcacccgcctcacccacagctgtcagtgggtacccctcccctctaaactccctctac
acccccactggagcaacagcaccgctgcagtcagtcacccccaccttgtaccaaaatctc
ctcttgtaa

DBGET integrated database retrieval system