KEGG   Notothenia coriiceps (black rockcod): 104947073
Entry
104947073         CDS       T04920                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04020  Calcium signaling pathway
ncc04144  Endocytosis
ncc04510  Focal adhesion
ncc04540  Gap junction
ncc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104947073 (pdgfra)
   04020 Calcium signaling pathway
    104947073 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104947073 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104947073 (pdgfra)
   04540 Gap junction
    104947073 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104947073 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104947073 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ncc04090]
    104947073 (pdgfra)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104947073 (pdgfra)
Protein kinases [BR:ncc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104947073 (pdgfra)
CD molecules [BR:ncc04090]
 Proteins
  104947073 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set C2-set_2 Herpes_gE DUF1955
Other DBs
NCBI-GeneID: 104947073
NCBI-ProteinID: XP_010771313
UniProt: A0A6I9N7A4
LinkDB
Position
Unknown
AA seq 1470 aa
MDGVKASLVFGGMLVVGLLVSVTSGLSPPTIVSNEEEFVLQPNSVFNISCTGKRNVVWAE
PLPKNTFVYPGYYTATLFIYNATVENTGYYMCTYQTQEGELEDEPEEDNEAGIYVFVPDA
LAPFVPETPENLVVPMETHGVPISCRVSDPNSHVTLRSVPSGEDMSAFYDHKMGFFGSLS
PGQYQCETSVNGHSIRSVIYTVETEVPAEMDHFDVEVKASEETVRAGQSFNITCVAPIGL
DFQQQWLHPKKQAMGAVQIKETSPDGVIYTLSIPKATSQDSGSYECSVTHIISGEVRVSS
VAVTVFEENSFVAVDHSGIQTSEFVSLLEETEYTILINAYPNPKVSWLKDGKAMPQTYYI
FTKTSHLEGNRYQSILTLRQPLVKDNGNYTITAISGSRTAHFSFTLKVKAPTAMMFPPSS
GPVLLPQVEEMVVPLHTPFTLTCRGEAKLAWDTPLDVHEQTQEDNSGLFVTTITVDNASA
MHTGYYTCFYTRNTTEDTEDSSIYIYVPDPDVPFVPSSVPFGNHVLSDQEEMEIQCRVSD
PSANVTLVNVDTQLPVPSFYDSKRGALGVFTAGTYVCKALVNGVEHDSEEYIVHGWTGGA
ALHVELTAKRTALLVGETIIVNCLARGSEILEDHWKYPGILANRAIKTVHENKRDQEILY
TLTIQKASIKDNGIYSCSITDIISDDSQIKELAIRVFASRFLSITPEFREYESAELDEVR
EFRAEISAFPSANVTWLKDGFPLSDMTAEITTSFQQLSETSYLSVLTLIRAKEEDSGNYT
IRVENGEHIRDVGLNLEVKVPAVILDLMDIHHGSAKGQAVVCITRGQPTPVVEWFVCKNI
KHCANDSSSWVPLPANSTEITMDSRFDEENNLESQVTFGHLESTLAVRCLARNEMAAVSR
EVKLVSNGPHPELTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEY
IYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPT
ARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPINIITEYCFYGDLVNHLHKNREN
FISLNPEKSKKEMDIFGINLVDESSRSYVILSFESKGDYMDMKQSDNTQYVPMLEMNNAS
KYSDIQKSDYDHPPSQKEGEMDDLMSEDINEGLTTTDLLSFTYQVAKGMEFLSSKNCVHR
DLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTSLSD
VWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGFRMSKPEHAPDDVYEMMMKCWNSEP
EKRPTFLGLSETVSTLLPSNYKKHYERVNHDFLKSDHPAVTRVCVENDDAYIGITQKSQG
KLKDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYGKRNRHGSQTSDESAIETGSSISTY
AKREGETLEDITLLDEMCLDCSDLGEDSFL
NT seq 4413 nt   +upstreamnt  +downstreamnt
atggatggggtaaaggcctctctcgtctttgggggtatgctggtggtaggcctactggtt
tcagttacttccggactgtcgccacctaccattgtttccaacgaagaagagttcgtcctg
cagcccaattccgtgttcaacataagctgtaccggtaaaagaaacgtcgtttgggctgaa
cccctgccgaaaaacaccttcgtttacccgggatactacacggcgacacttttcatttac
aatgcaactgtagaaaacaccggctactacatgtgcacctatcaaacacaggagggtgaa
ctggaggacgaaccggaagaagacaatgaggccggaatatatgtcttcgtcccagatgcc
ctggctcccttcgtcccagaaacccctgaaaacttggtagtcccaatggagacacatggg
gtccccatctcctgccgtgtgtcagaccccaactcccatgtcaccctgaggagtgtcccc
agtggagaggacatgtctgccttctatgaccacaaaatgggcttctttggaagtctctcg
cctgggcagtaccagtgtgaaacctcagtgaacggccactctatcagaagtgttatttac
actgtggagactgaggtccctgctgagatggaccattttgacgtggaagtaaaagccagt
gaggagacggtgagagcagggcagtcctttaacatcacgtgtgtcgctcccattggactg
gactttcagcagcagtggctccatcccaaaaaacaggctatgggtgcagttcagataaaa
gaaacctctcctgacggggtcatctacaccctcagtatcccaaaagccacctctcaggac
agcggcagctacgagtgctccgtcacccacatcatcagcggcgaggtcagagtcagcagt
gtggctgtcaccgtctttgaagaaaactcctttgtggcagtggatcacagcgggattcaa
acatcagaatttgtcagcctcttagaggagacagagtataccatcctcattaatgcctac
ccaaaccctaaagtgtcgtggctgaaagacggcaaagccatgccacagacctactacatc
ttcaccaaaacaagccacctcgaaggaaatcggtatcaaagcattctgacattacggcag
cctttggtgaaagacaacgggaattataccatcacagccatcagtggctctcgcactgct
cacttctcctttaccctcaaagtgaaagctcccactgcaatgatgttcccaccatcctcg
ggccctgtgctgctgccacaggtggaggagatggtggtgcccctccacactcctttcacc
ttgacctgtcggggagaagcaaaactagcctgggatacgccactggatgtgcacgagcaa
acacaagaggacaacagcggcctttttgtcaccaccatcactgtggacaacgccagtgca
atgcacactggctactacacctgcttctacaccagaaataccactgaggacacagaagac
agcagcatctacatctatgtgccagatccagacgttccctttgtgccctcctcggttcct
tttggcaaccatgtgctgtcggaccaagaggagatggagattcaatgcagggtgtctgat
cccagtgctaacgtgaccctggttaacgttgacacccagctacctgtgcccagcttttat
gacagcaagaggggcgctttgggagtattcactgctggtacctacgtctgtaaggctcta
gtaaacggagtggaacacgacagcgaggaatacatcgtccacggctggacaggtggcgct
gcactgcatgtcgagctgacagccaaacgcactgctctgcttgtgggagaaaccatcata
gtgaactgtctggctaggggatctgagattctggaagaccactggaaataccctggaata
ctggctaatcgtgctatcaagacagtgcatgagaataagagggatcaggagatcctttac
accctgacaatccaaaaggcctcaatcaaggacaacggcatctactcctgctccatcact
gatatcatcagtgatgacagccagataaaggaactagccattcgagtttttgcaagtagg
ttcttgtccatcacaccggagttcagggaatatgaatcggcagagctggatgaggttcgg
gagttcagggctgaaatcagtgctttccccagtgctaatgtcacctggctgaaggatggc
ttcccactgagcgacatgacggcggagatcaccaccagcttccagcagctcagcgagacc
agctacttgagcgttcttaccctgatccgggccaaagaggaggacagcgggaactacacc
atccgtgtggaaaatggagaacatattcgtgacgtcgggttaaacctggaggtcaaagtt
cctgcagttattctggacctgatggacatccaccatggctcagccaaaggccaggctgtg
gtgtgcataaccagagggcagcccactcctgtggtggagtggttcgtctgcaagaacatc
aaacactgtgccaatgactcgtcttcctgggtgcccctccccgccaactccacggagatc
acaatggattcgcgctttgacgaggaaaataacctggagagtcaagtcacgtttggtcat
ctggaaagcacgctggcagtgcgctgcctcgccaggaacgaaatggccgccgtcagcagg
gaggtcaaactggtgtccaatggccctcacccagagctgactgtagctgctgctgtgctg
gtgctcctggtcattgtcatcatctcactcattgtcttggttattatctggaaacagaag
ccacgttatgagatccgctggagggtcatagagtctgtgagcccagacggccatgagtac
atctatgtggatcccatgcagcttccctacgactccagatgggaattcccccgtgacaga
cttgtgctcggtcgtatccttggctctggagcctttgggaaggtggtcgagggcactgct
tacggactcagccgctcccaacctgtcatgaaggtggcagtgaaaatgctgaaacccacg
gcccgctccagtgagaaacaggccctgatgtctgaactgaagatcatgactcatcttgga
ccacatctcaacattgttaacctcctgggagcgtgcaccaagtcaggccctatcaacatt
atcactgaatactgcttctacggggacctggtcaaccatctgcacaagaacagggagaac
ttcatcagcctgaacccagagaaaagtaaaaaagagatggatatctttggaatcaaccta
gtggatgagagcagcaggagctatgtgattctgtcctttgagagcaaaggagactacatg
gatatgaagcagagtgacaacactcagtatgttcccatgctggagatgaacaatgcctct
aagtactcagacatccagaaatctgactatgaccaccctccctctcagaaagagggcgag
atggacgacctgatgtcagaggacattaacgagggcctcaccaccacagatctgctcagt
tttacttaccaagtggccaaaggcatggagttcctgtcttccaaaaattgtgtgcatcgg
gacctcgctgccaggaatgtcctcctctctcagggcaagatagtgaagatctgtgacttc
ggactggcccgagacatcatgcatgacaacaactatgtctccaaagggagtactttcctg
ccagtgaagtggatggcgccagagagtatttttgacaacctgtacaccagtctcagtgat
gtttggtcatacggcatcctgctctgggagatattctccttaggtggcaccccataccca
gggatggtcgtggattcaagcttctacaacaagatcaagagtggattcaggatgtccaaa
ccagagcacgcacctgatgacgtgtacgagatgatgatgaagtgctggaacagcgagccg
gaaaagaggccgactttccttggtctgagtgaaactgtttccactttgctgccctccaac
tacaagaagcattatgagagggtgaaccatgacttcctgaagagcgaccaccccgctgtg
actcgggtttgcgtggaaaacgacgacgcctatatcggcatcacccaaaagagccagggc
aagctgaaggacagggaaagcggcttcgatgagcagcggctgagctctgacagcggctac
atcatccccctgccagacctggaccccttatctgacgatgaatatggaaagaggaacaga
cacggctctcagacctccgacgagagcgccattgagacgggctccagcatctctacttat
gctaagcgtgagggtgagactctggaggacatcacgctgctggacgagatgtgtctggac
tgtagtgacctgggggaggacagcttcctgtga

DBGET integrated database retrieval system