KEGG   Notothenia coriiceps (black rockcod): 104947293
Entry
104947293         CDS       T04920                                 

Gene name
smurf2
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04120  Ubiquitin mediated proteolysis
ncc04144  Endocytosis
ncc04340  Hedgehog signaling pathway
ncc04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104947293 (smurf2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104947293 (smurf2)
   04350 TGF-beta signaling pathway
    104947293 (smurf2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104947293 (smurf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104947293 (smurf2)
   04121 Ubiquitin system [BR:ncc04121]
    104947293 (smurf2)
   03029 Mitochondrial biogenesis [BR:ncc03029]
    104947293 (smurf2)
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     104947293 (smurf2)
Membrane trafficking [BR:ncc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    104947293 (smurf2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104947293 (smurf2)
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  HECT type E3
   104947293 (smurf2)
Mitochondrial biogenesis [BR:ncc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    104947293 (smurf2)
SSDB
Motif
Pfam: HECT WW HPS3_N
Other DBs
NCBI-GeneID: 104947293
NCBI-ProteinID: XP_010771574
UniProt: A0A6I9N0N6
LinkDB
Position
Unknown
AA seq 706 aa
YIGKADSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLNKLGPNDNDT
VRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWER
PTRPASEYSSPSGRPLSCVVDENTPVMTPVNGAEASVPQGVQRVQERRVRSQRHRNYMSR
THLHTPPDLPEGYDLNLAKRANKAELNPSLCLELLSQEDRDLSNVNCEELGPLPPGWEIR
NTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPSPNGSRVAMESQNTNLSQTPPLKEQV
VTGVPPQPLSPAQMPEEAECLTVPKYKRDLVQKLKILRQELSAQQPQAGHCRIEVCREEI
FEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRD
DIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDM
ESVDPDLHNSLVWILDNDINGVLDHTFCVEHNAYGEIIQHELKPNGKSVNVTEDTKKEYV
RLYVNWRFLHGIEAQFLALQKGFNEVIPQHLLKSFDEKELELIVCGLGKIDIADWKSNTR
LKHCTTDTNIVKWFWKAVETFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQ
IDANANNLPKAHTCFNRIDIPPYESYDKLYDKLLTAIEETCGFAVE
NT seq 2122 nt   +upstreamnt  +downstreamnt
atacattggaaaggcagactcaatcaccatcagcgtatggaatcacaagaagatccacaa
aaagcagggtgcaggtttcctcggctgtgtccgcctcctgtccaacgcaatcaacagact
caaagacactggctatcagagactggacctgaataagctgggcccgaatgacaatgatac
tgtgagaggtcaaatagttgtaagtcttcagtccagagatcgcatcgggacaggagggcc
ggtagtggactgcagccgcttgttcgacaacgacctgcctgatggttgggaagaaaggag
gacggcctctgggaggatacagtacctgaaccacatcacacgtaccacgcagtgggagag
accgaccaggccagcgtcggagtactccagcccctcagggcgtcctctgagctgtgtggt
ggacgagaacacgccggtgatgacgcccgtcaacggggctgaggcgagcgtgccgcaggg
cgtacagcgggtccaggagagacgggttcgatctcagcggcatcgcaactacatgagtcg
aacacacctgcatacaccccctgacctgcctgagggttatgacctcaacttggccaaacg
tgccaacaaagcagagctcaatccgtcgctgtgcttggagctcctttctcaagaggacag
ggatctcagcaatgtgaactgtgaggagctgggcccgctgcctccaggctgggagataag
aaacacagccacgggtcgcgtctactttgtcgaccacaacaaccggacaactcagttcac
agacccgcgactctctgctaacctgcatctagtactcaacccaagtccaaatggttcccg
tgtggccatggaaagccaaaacactaacctcagtcaaacgcctccgttgaaggagcaggt
tgttaccggggtcccgccgcagcccctctcccccgcccagatgcctgaggaggcggagtg
cctgacggtgcccaaatacaagagagacctggtgcagaagctgaaaatcctgcggcagga
gctctctgcgcaacaaccacaggccggccactgccgcatcgaggtctgccgtgaggagat
atttgaggagtcgtaccggcaggtgatgaagatgcgtccgaaagatctctggaaaagact
gatgatcaaattcagaggagaagagggactggactatggcggggtagcaagggaatggtt
atacctgctgtcccacgagatgctgaacccgtactacggcctgttccagtactccagaga
cgacatctatactctgcagatcaacccggactctgctgtcaacccggagcacctgtcgta
cttccacttcgtgggtcgcatcatgggcatggcggtgttccacggccactacatcgacgg
aggcttcactctgcccttctacaaacagctgctggggaaacccatcacgctggacgacat
ggagtccgtcgaccccgacctccacaacagcctcgtctggatcctggacaatgacataaa
cggcgtcctggaccacactttctgtgtggagcacaatgcctacggagaaatcatccaaca
tgagctcaaacccaacggcaagagtgtgaacgtcacagaggacaccaagaaggagtatgt
caggttgtatgtgaactggcgtttcctgcatggcatcgaggctcagtttctggctctgca
gaaaggtttcaacgaggttatcccacaacacctgctcaaatcctttgatgagaaagaact
ggagctgattgtgtgtggcctgggaaagatcgacatcgctgactggaagtccaacacccg
tctgaagcactgcaccaccgacaccaacatcgtcaagtggttctggaaagccgtggagac
gtttgacgaggagaggagggcccggctgctgcagtttgttaccggctcctccagagtgcc
cctgcagggcttcaaggctttacaaggagctgcagggcccagactcttcaccattcatca
gatcgatgcaaacgccaacaatctgcccaaagcccatacctgcttcaaccggattgacat
cccgccctacgagagctacgacaagctatacgacaagctgctgactgcgatcgaggagac
ctgtggcttcgcagtggaatga

KEGG   Notothenia coriiceps (black rockcod): 104956912
Entry
104956912         CDS       T04920                                 

Gene name
smurf1
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF1 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04120  Ubiquitin mediated proteolysis
ncc04144  Endocytosis
ncc04340  Hedgehog signaling pathway
ncc04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104956912 (smurf1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104956912 (smurf1)
   04350 TGF-beta signaling pathway
    104956912 (smurf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104956912 (smurf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104956912 (smurf1)
   04121 Ubiquitin system [BR:ncc04121]
    104956912 (smurf1)
   03029 Mitochondrial biogenesis [BR:ncc03029]
    104956912 (smurf1)
Enzymes [BR:ncc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     104956912 (smurf1)
Membrane trafficking [BR:ncc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    104956912 (smurf1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104956912 (smurf1)
Ubiquitin system [BR:ncc04121]
 Ubiquitin ligases (E3)
  HECT type E3
   104956912 (smurf1)
Mitochondrial biogenesis [BR:ncc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    104956912 (smurf1)
SSDB
Motif
Pfam: HECT WW C2 Laminin_G_2
Other DBs
NCBI-GeneID: 104956912
NCBI-ProteinID: XP_010782788
UniProt: A0A6I9P7A9
LinkDB
Position
Unknown
AA seq 732 aa
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVKSTLDP
KWNQHYDLYIGKTDSITISIWNHKKIHKRQGAGFLGCIRLLSNAISRLKDTGYQRLDLCK
LNPSDSDAVRGQIVVSLQTRDRIGSGGPVVDCRGLLENDGPVFEGCFSEEPLPYSDPTGA
AGGGNCRLDSPGQEGRLQTQRIRGQDSRGHGHTPQNRPHGHQPPDLPEGYEQRTTVQGQV
YFLHTQTGVSTWHDPRIPRDLASVSCEELGPLPVGWEVRSTVSGRIYFVDHNNRTTQFTD
PRLHTIISQQSQAKESSQAPQMEVGGEEVGGVGVVGGVGGGDGDVAARYERDLVHKLKLL
RHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAR
EWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRVMGLAVFHGHY
INGSFTLPFYKQLLGKPITLIDLETTDPELHKSLVWILENDITTVLDHTFCVEHNAFGKF
SQHELKPNGRNIPVTEDNKKEYVRLYVNWRFMRGIEAQFLALQKGFSELIPQHLLKPFDH
KELELIIGGLGKIDLADWKTNTRLKHCTSESNVVRWFWEAVEAFSEERRGRLLQFVTGST
RVPLQGFKALQGSTGSAGPRLFTIHLIDANTDNLPKAHTCFNRIDVPPYESYEKLYEKLL
TAVEETCGFAVE
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcgaatcctgggactcggaggaacgggtccagcatcaaaattcgactgacagtatta
tgtgccaagaacctcgcaaagaaagacttctttcgactaccggatccctttgccaaggtt
gtggtggatggatcgggtcaatgccactctacagacacagtcaagagcacactggacccc
aaatggaatcagcactacgacctctacatcggaaaaacagactccatcacgatcagcata
tggaaccacaaaaagatccataaacggcagggggcgggcttcctgggctgcatacgactg
ctttctaacgccatcagcaggctaaaagacacgggataccagcgactagacctctgtaag
ctgaacccctcggacagtgacgcagtgcgggggcagatcgtagtgagcttacagacgcga
gatcgcatcggcagcggtggccctgtggtggactgcaggggactgctggaaaatgacggg
cctgtgtttgagggatgcttcagtgaagagccgctgccctactcggaccccaccggggca
gcgggaggcgggaactgtcggctcgactcgcccggtcaggagggtcgtcttcagacgcag
cgaatcagagggcaggactcgagaggccacggacacacaccccaaaacagaccgcacgga
caccagccgcccgacctgccggagggatacgaacaaagaacgacggtgcagggccaggtc
tacttccttcacacacagacgggcgtcagcacctggcacgaccctcgaataccgcgggat
ctggccagtgtgagctgtgaggagctgggcccgctgccggtgggctgggaggtccgcagc
accgtgtcggggcggatctactttgtggaccacaacaaccgaaccacacagttcacagac
ccgcgcctacacaccattatcagccagcaaagccaagcgaaggaatcctcgcaagccccc
cagatggaggtggggggtgaggaggtgggaggcgtcggagtggtcgggggagttggaggc
ggagatggagacgtggcggcgcgatacgagagagacctggtgcataaattaaagctgctc
cgacacgagctgtccttacagcagcctcaggccggacactgtcgcatcgaggtgtccaga
gaggagatctttgaggagtcatatcggcaaataatgaagatgaggcccaaagacctgaag
aagcgtctgatggtgaagttcagaggagaggaggggctggactacggtggagtggccagg
gagtggctctacctgctgtgtcatgaaatgttgaacccctattacggcctgttccagtac
tccacagacaatatctacacactacagatcaaccccgactcctccatcaaccccgaccac
ctgtcttatttccactttgttggccgggtgatgggcctggcagtttttcacggtcactac
atcaacgggagcttcacgctgcccttctacaaacagctgctaggaaaacccatcacgctc
atcgacctggagaccaccgaccccgagctgcacaagagtctcgtctggatactagagaac
gacatcactacggtcctcgaccacaccttctgcgtggagcacaacgccttcgggaagttc
tcacaacacgaactcaaacccaacggccgcaatatccccgtcaccgaggacaacaaaaag
gaatacgtcagactttacgtgaactggcggtttatgcgaggaatcgaagcccagtttctg
gctctgcagaagggattcagtgagctcatcccccagcacctcctcaaacctttcgaccac
aaagaactcgagttgatcatcggtgggctggggaagatcgacctggcggactggaagacc
aacacgcgtctgaagcactgcaccagtgagagcaacgtggtgcggtggttctgggaggcg
gtggaggccttcagcgaggagaggagaggacgcctcctgcagttcgtcacaggctccacc
cgagtcccgttacaggggttcaaagcgttgcagggttctacaggttctgcaggaccaagg
ctcttcaccatccacttgatagacgccaacacagacaacttgcccaaggctcacacgtgt
tttaaccggatagacgtccctccctacgagtcctacgagaagctctatgagaaactgctg
acggctgtggaggagacatgcggcttcgctgtggagtga

DBGET integrated database retrieval system