KEGG   Notothenia coriiceps (black rockcod): 104947367Help
Entry
104947367         CDS       T04920                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00010  Glycolysis / Gluconeogenesis
ncc00051  Fructose and mannose metabolism
ncc00052  Galactose metabolism
ncc00500  Starch and sucrose metabolism
ncc00520  Amino sugar and nucleotide sugar metabolism
ncc00524  Neomycin, kanamycin and gentamicin biosynthesis
ncc01100  Metabolic pathways
ncc01200  Carbon metabolism
ncc04910  Insulin signaling pathway
Module
ncc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104947367 (hk1)
   00051 Fructose and mannose metabolism
    104947367 (hk1)
   00052 Galactose metabolism
    104947367 (hk1)
   00500 Starch and sucrose metabolism
    104947367 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    104947367 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104947367 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104947367 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ncc04131]
    104947367 (hk1)
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104947367 (hk1)
Membrane trafficking [BR:ncc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104947367 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 104947367
NCBI-ProteinID: XP_010771696
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLKEITQRFKRELVKGLGRDTNPTAV
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVRVSHEKKQTVQMESEIYDTPEDIIH
GTGTKLFDHVAECLCDFMEKHSIKDKKLPVGFTFSFPCQQTKLDEGFLVTWTKRFKASGV
EGMDVVQLLNKSIKKRGDYEADIMAVVNDTVGTMMTCGFDDRRCEVGIIIGTGTNACYME
ELRHIDQVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSINPGKQLFEKMVSGM
YLGELVRLILVKMAREGLLFEGRITPELLTKEKIETKHISAIEKSKEGLMRTKEILQRLG
VEPSHDDCIAVQHVCAIVSFRSANLIAAALAGILLRLKENKGVARLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDTDIRFLLSESGSGKGAAMVTAVAYRLAEHSREITQTLSEFLLS
TEQLLEVKKRMRIEIQNGLSKSTQDSATVKMLPTFVNSTPDGSEHGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGF
TFSFPCRQTSLDAGILVTWTKGFKATDCEGENVVGLLRDAIKRREEFELDVVAIVNDTVG
TLMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIEMIDGDEGRMCVNMEWGAFGDNGCLDD
MRTEYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSSCDDSIIVKRVCGAVSHRAAQLCGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSGVMHQTVKELAPKCNVNFLLSEDGSGKG
AALITAVGCRLRQELSNK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcccagctactagcctattacttcactgaactcaaggatgatcaggttaaa
aagatcgataagtacctgtactccatgcgtttctctgacgagacgttgaaggagatcacg
cagcgcttcaagagggagctggtgaaaggcctggggcgggacaccaaccccaccgccgtg
ctgaagatgctgccaacgttcgtgcggtcgatccctgatggctcagaaaagggagacttc
attgcgttggatttgggaggcagtaacttcaggatcctccgggtcagagtgagccatgag
aagaaacagacggttcagatggagagtgaaatctacgacacaccggaggacatcattcac
ggcactggaacaaaactgttcgaccatgtggcagagtgtctctgtgacttcatggaaaaa
cacagcatcaaagacaagaaactcccagttggatttactttctccttcccctgccagcag
accaaactagacgagggctttctggtaacgtggacaaagcgtttcaaggccagtggagtg
gagggaatggacgttgtccagctgctcaacaaatctataaagaagcgaggagactatgaa
gctgacatcatggcagtagtgaatgacaccgtgggaacgatgatgacctgtggttttgat
gaccggcgctgtgaagtcggcatcatcataggtacgggcaccaatgcgtgctacatggag
gagctgcgccacatcgaccaggtggagggggacgagggccggatgtgtgtgaacacggag
tggggggccttcggagacgacggcaggctggaggacatcaggacagagttcgacagagag
atagacagaggctccatcaaccccgggaaacagctatttgagaagatggtcagcgggatg
tacttgggggagctggtccgtctgatcctggtgaagatggccagagaaggcctgctgttc
gaggggaggatcactcctgagctgctcactaaggagaagatcgaaaccaaacacatctca
gccatagagaagagtaaggaggggttgatgagaaccaaagagattttacaaagacttggc
gtggagccctcgcatgacgactgcatcgctgtgcagcatgtctgtgccattgtgtctttc
cgttcggccaacctgatcgctgcggcgctggccggcatcctgctcaggctgaaggagaac
aaaggcgtggcccgactccgaaccactgtaggcatcgatggatctctgtacaagatgcac
ccacaatatgcccgtcgtctccataagacggtccgtcgtttggtgccggacactgatatt
cggttcctcctctcagagagcggcagtgggaaaggagctgccatggtaacggctgtggcc
tatcgcctcgccgaacactcacgagagatcacccaaacactgtctgagttcctcctgtcg
accgaacaactgctggaggttaagaagagaatgaggatagagatccaaaatggcctttca
aagagcactcaggactctgctactgtcaaaatgctgccaacctttgtgaacagcactcct
gatggctcagagcatggagacttcctggcgttggatttaggaggaaccaacttcagagtt
ctgttggtaaagattcgttcaggcaagcggagaaccgtggagatgcacaacaagatctac
gctattcctctggaagtgatgcagggcacaggggaggagttgtttgatcacattgtgcag
tgtatcagtgacttcctggactacatggggatgaagaacactcgtcttcctctgggcttc
accttctccttcccctgcagacagaccagcctggacgctggaatccttgtgacatggacg
aagggcttcaaggcgacagactgtgaaggagaaaatgtggttggtctgttgagagatgcc
attaagaggagagaggaatttgagctggatgtggtggccatagtgaacgatacagtggga
accttgatgacctgtgcctacgaagaacccacctgtgagattggacttatcgctggcact
ggcagtaatgcatgttacatggaggagatgaggaacattgagatgatcgatggagacgag
ggccgcatgtgtgtcaacatggagtggggggctttcggagacaatggatgccttgatgac
atgaggacagagtacgaccgcgctgtggatgacttatccctgaatccaggcaaacaaaga
tatgagaaaatgtgcagcggcatgtatctcggggaaattgtgcgaaacatcctgatagac
atgaccaagagaggattcttgttcagaggacagatctctgaaacactgaagaccagaggc
atctttgagacaaagttcctctcacagatagagagtgatagattagctctgctgcaagtg
agatccatcctgcaacacttagggctggacagctcctgtgatgacagtatcatagtcaaa
agggtttgtggggcagtgtcccatcgtgcagctcagctttgtggggcagggatggcggct
gtggtcgataagatcagagagaaccgaggactggaccatctggacatcactgtgggcgtg
gacgggaccctctacaaactacatccacatttctcgggggtcatgcaccagacggtaaag
gaactggctcctaagtgtaacgtcaacttcctgctgtcagaggacggcagtgggaaaggt
gccgcactcatcacagccgtggggtgccgcttaagacaggagctgagcaataaatag

DBGET integrated database retrieval system