KEGG   Notothenia coriiceps (black rockcod): 104947711
Entry
104947711         CDS       T04920                                 

Definition
(RefSeq) uncharacterized protein C16orf52 homolog
  KO
K23663  modulator of smoothened protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104947711
SSDB
Motif
Pfam: Atthog Cyt_bd_oxida_I LtrA DUF998 L_HMGIC_fpl DUF423 TctB
Other DBs
NCBI-GeneID: 104947711
NCBI-ProteinID: XP_010772084
UniProt: A0A6I9N2D2
LinkDB
Position
Unknown
AA seq 140 aa
MLICHLSAGALTVGLVRQCQTIHGRDRTCIPPRLPPEWVTTLFFIIMGIISLTVTCGLLV
ASHWRREATKYARWIAFTGMILFCMAALIFPIGFYINEVGGQPYKLPNNTVVGSSYVLFV
LSIFFTIVGLLFAGKVCLPG
NT seq 423 nt   +upstreamnt  +downstreamnt
atgttaatatgtcatctctctgcaggtgccctcacagtcggtctggtccgacagtgtcag
accatccacgggcgagaccggacctgtatccccccccggctgcccccggagtgggtcacc
acactgttcttcatcatcatgggcatcatctccctcacagtcacctgtggactgctcgtg
gcatcacactggcgccgagaagccaccaaatacgcccgatggatcgcctttactggcatg
atcctgttctgcatggcggcgctcatcttccccataggcttctatatcaacgaggtgggg
gggcagccgtacaagctgcccaacaacacggtggtgggctcctcgtacgtgctctttgtc
ctctccatcttcttcaccatagtgggacttctgtttgccggcaaagtctgcctcccaggc
tga

KEGG   Notothenia coriiceps (black rockcod): 104958530
Entry
104958530         CDS       T04920                                 

Definition
(RefSeq) uncharacterized protein C16orf52 homolog B-like
  KO
K23663  modulator of smoothened protein
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104958530
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl YIF1 THEG4
Other DBs
NCBI-GeneID: 104958530
NCBI-ProteinID: XP_010784574
UniProt: A0A6I9P2E4
LinkDB
Position
Unknown
AA seq 117 aa
MDKLTVISGCLFLTADIFAIASIANPDWISTGGASGTLTVGLVRQCQTIHGRERTCFPPQ
LPPEWITTLFFIILGIISLTVTCALLVMSHWRREAARYARWIAFTGSTFVSIVASSL
NT seq 354 nt   +upstreamnt  +downstreamnt
atggataaactcacggtgatttcaggatgcctcttcctcactgcagacatcttcgccatc
gccagcatcgccaacccggactggatcagcactggaggagcatccggcactctgacagta
ggtctcgtccgtcagtgccagacgatccacggcagagagcggacctgcttccccccccag
cttcctccagagtggatcaccacgctcttcttcatcatcctgggcatcatctccctcacc
gtcacctgcgctctgctggtgatgtcccactggcgccgagaagccgcccgatacgcccga
tggatcgccttcacaggaagtacgttcgtttccatcgtagccagctccctttga

DBGET integrated database retrieval system