KEGG   Notothenia coriiceps (black rockcod): 104948695
Entry
104948695         CDS       T04920                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04012  ErbB signaling pathway
ncc04068  FoxO signaling pathway
ncc04110  Cell cycle
ncc04115  p53 signaling pathway
ncc04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104948695
   04068 FoxO signaling pathway
    104948695
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104948695
   04115 p53 signaling pathway
    104948695
   04218 Cellular senescence
    104948695
SSDB
Motif
Pfam: CDI DUF2576
Other DBs
NCBI-GeneID: 104948695
NCBI-ProteinID: XP_010773221
UniProt: A0A6I9NFG8
LinkDB
Position
Unknown
AA seq 181 aa
MKDFTWTRLQSADNCITMDLHKQTLTALGNSPAQRSLFGPVDREQLQVEYQASLRRDLDQ
ACQRWGFDFVSDKPLEQSVFQWEGIPGSEVPLLYRSCLPGLGHTEGQRAAEADLKPRERG
RVGQPHSEDENIHCSPERCELHPEKTPERREDTGLKRKQTNITDFYQSKRRFIWTPRKSG
E
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaaggattttacctggaccagactgcagtcagctgataattgcataacgatggatctt
cacaagcagaccctgaccgccctggggaacagcccggcccaaaggagcctgtttggcccc
gtggacagagagcagctgcaggtggagtaccaggcctccctgaggagagacctggaccag
gcttgccagcgatggggctttgacttcgtctcagataagcctctggagcagagcgtgttc
cagtgggagggcatcccaggcagcgaggtacccctgctctacagatcatgtctgcctggt
ctgggacacacagaaggtcagagagcagcagaggcagatctaaagccacgggaaagagga
agggtggggcagcctcacagtgaggatgagaacatccactgctcaccagagagatgtgag
ctccacccggagaaaacaccagagagacgagaggacacagggctgaagaggaaacagacc
aacataacagatttctaccagtctaaaagaagattcatttggacgccacgcaaatccgga
gagtga

DBGET integrated database retrieval system