KEGG   Notothenia coriiceps (black rockcod): 104949017Help
Entry
104949017         CDS       T04920                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00020  Citrate cycle (TCA cycle)
ncc00190  Oxidative phosphorylation
ncc01100  Metabolic pathways
ncc01200  Carbon metabolism
Module
ncc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ncc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104949017
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104949017
Enzymes [BR:ncc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104949017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 104949017
NCBI-ProteinID: XP_010773596
LinkDB All DBs
Position
Unknown
AA seq 283 aa AA seqDB search
MSAACLSSLSRCGVLSFRSPAGLVAVRYAQTAAAPVAEPRIKKFQIYRWDPDTPGDKPRM
QTYDIDLNTCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNINGGNTLACLNKID
TNTSKPSKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDEANEGKEQYLQTVEDRQ
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPF
SLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKAVAV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgcttgcctctcgtccttgagccgctgtggggttttgtcgttccgctcgccc
gcaggactggtggcggtgcggtatgcccagacagcggcggctccagtagctgagcccaga
ataaagaagttccagatttacagatgggaccccgacactccaggggacaaaccccgcatg
cagacctacgacatcgacctcaacacatgtggcccgatggttcttgacgccctgatcaag
ataaaaaatgaaatggacccgaccctgaccttccgccgctcctgcagagaaggtatttgt
ggatcctgtgcaatgaacattaatggaggaaacacacttgcctgtctcaacaagattgac
accaacaccagcaagccctctaagatttaccctctgccacacatgtatgtggtgaaggac
ctcgtacctgacatgagtaacttctacgcccagtacaagtccatcgagccctacctgaag
aagaaggatgaggccaacgaagggaaggagcagtacctgcagaccgtggaggacagacag
aaactggacgggctgtacgagtgtatcctgtgcgcctgctgcagcaccagctgccccagc
tactggtggaacggagacaaatacctcggccccgctgtgctcatgcaggcgtaccgttgg
atgatcgactcccgagacgagttcacagaggaacgtctggccaagctgcaggatcctttc
tccctctaccgctgccacaccatcatgaactgcaccaagacctgccccaagggtctgaac
ccaggaaaagcgatagctgagatcaagaagatgatggccacatacaaggagaagaaggcg
gtcgctgtctga

DBGET integrated database retrieval system