KEGG   Notothenia coriiceps (black rockcod): 104949666
Entry
104949666         CDS       T04920                                 

Definition
(RefSeq) indian hedgehog B protein-like
  KO
K11989  indian hedgehog
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104949666
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104949666
Peptidases and inhibitors [BR:ncc01002]
 Cysteine peptidases
  Family C46: hedgehog family
   104949666
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Intein_splicing Vint
Other DBs
NCBI-GeneID: 104949666
NCBI-ProteinID: XP_010774360
UniProt: A0A6I9NIQ3
LinkDB
Position
Unknown
AA seq 409 aa
MLLPRLVTCLAGCAFLLAPGSEGCGPGRGHGKRRSPRKLAPLSYKQFSPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNLWHGV
RLRVTEGWDEDGHHSEESLHYEGRSVDITTSDRDRNKYAMLARLAVEAGFDWVYYESKAH
IHCSVKSDHSVAAKSGGCFPGEASVMLSSGEQKSLSNLRPGERVLTVGNDTGELIYSEVL
LFLDHDLVTRTLFYTLHTESGAHISLTAAHLVFVSEGNCTEGMLPRSLRSVYASDAQIGQ
CVVVQTGGEGRLSRVKRVTLRTSRGAFAPLTQQGTLVVNGVLVSCYAVVEQHALAHWAFS
PLRILHSWTGFTGSHQSHEGVHWYSLLLHWLGRKVLDPGSFHPLGLDQG
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgctgctccccaggctcgtgacgtgcctcgcggggtgcgccttcctcctcgcgccgggg
agcgagggctgcggaccgggcagaggtcacggtaagagacggtctccacggaaacttgcc
cctctttcctacaagcagttcagccccaacgtggcggagaagacgctaggagccagcggg
aggtacgaggggaaaatcacccgtaactccgagcgcttcaaggagctcacccccaattac
aacccggacatcatcttcaaggatgaggagaacacaggtgcagaccgcatgatgacacag
cgctgcaaagacaagctgaactctctggccatctcggtgatgaacctgtggcatggggtc
cgtctgagggtcacggagggctgggacgaggacggccatcactcggaggaatcccttcac
tacgaggggagatccgtggacatcaccacctccgaccgggacagaaacaagtacgccatg
ttggcccgcctggccgtggaggccggcttcgactgggtctactacgagtccaaagcccac
atccactgcagcgtcaagtcagatcactccgtggcggctaaatctggcgggtgtttcccc
ggcgaggcctcggtgatgttatcgagcggcgagcagaagtctctgagcaaccttcgacct
ggggagcgcgtcctaacggtgggaaacgacaccggggagttaatctacagcgaagtcctg
ctcttcctggaccacgacctcgtgacccggacgcttttctacacgctgcacactgagtcc
ggcgcccacatttctctcaccgccgcgcacctcgttttcgtgtcggaggggaactgcacc
gaggggatgttgccacgtagcctcagatcggtgtatgctagtgacgctcaaataggacag
tgtgtggtggtgcaaacgggtggagaagggcgtctttctcgggtcaaacgggtcactttg
aggaccagcaggggtgcgtttgctccgctcacccagcaggggacgctggtggtgaacggc
gtgttggtttcctgctacgcggtggtggagcagcacgccctcgctcactgggctttctct
cctctgaggatcctccacagctggactggattcactggttcccatcagagccatgagggg
gtccactggtactctctgctcttacactggctgggcaggaaggtgttggacccggggagc
tttcatccactgggcctggatcagggctga

KEGG   Notothenia coriiceps (black rockcod): 104951474
Entry
104951474         CDS       T04920                                 

Gene name
shh
Definition
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104951474 (shh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104951474 (shh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ncc00536]
    104951474 (shh)
Peptidases and inhibitors [BR:ncc01002]
 Cysteine peptidases
  Family C46: hedgehog family
   104951474 (shh)
Glycosaminoglycan binding proteins [BR:ncc00536]
 Heparan sulfate / Heparin
  Morphogens
   104951474 (shh)
SSDB
Motif
Pfam: HH_signal Hint Intein_splicing Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 104951474
NCBI-ProteinID: XP_010776438
UniProt: A0A6I9NN43
LinkDB
Position
Unknown
AA seq 412 aa
MLLWTRIVLVGLICLSLVSSGMGCGPGRGYGRRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNTDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNQWPGV
KLRVTEGWDEDGHHFEESLHYEGRAVDITTSDRDKSKYGTLSRLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSSTVTLQDGTQKPVKLLQSGDRVLAADAHGNPIYTDFIM
FIDQDSTTRRLFYVIETESGEKITLTAAHLLFVGQNNTENTDEMSAVFASQVRTGQTVFV
FDAERRRLEPVCVKRIFTHEYEGSFAPVTVQGTVVVDQVLASCYAVIQDHDLAHWALAPV
RFFYWVNSLLFQRPTSAQTDGVHWYSKILFQLGTWLLDSHSIHPLGMSVYTS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgctgctgtggaccagaatcgtattggtcggtctcatctgcttgtccttggtttcctct
gggatgggatgtggaccgggcagggggtatggaaggagaagacacccgaagaaactgaca
cctcttgcctacaagcagttcatccccaacgtggcggagaagaccctcggggcaagcgga
agatacgaaggcaagatcaccagaaactccgagcgatttaaagaactgactcccaattat
aacacagacatcatattcaaggatgaggagaacaccggagcggacaggctcatgactcag
agatgtaaagacaagctgaactctctggccatctcagtgatgaaccagtggcccggggtc
aagcttcgggtcacggagggctgggacgaggacgggcaccacttcgaggagtcgctccac
tacgagggccgagccgtggacatcaccacctcggacagagacaagagcaaatacggaact
ttgtccagactggcggtggaagcgggattcgactgggtctactacgagtccaaagcgcac
atccattgctctgtgaaagcagaaaactcagtggctgcaaagtcaggcggctgcttccca
ggatcctccacggtcaccctgcaggatggcacccagaagccggtcaaactcctccagagc
ggggacagggtcctggcagcggatgcgcacggaaacccgatttacaccgacttcatcatg
ttcatagaccaagactcgaccaccaggaggcttttctacgtgatcgaaaccgagtcgggg
gagaaaatcaccctcacggcagctcacctgctgttcgtgggtcaaaacaacaccgaaaac
acggatgaaatgtcggcagtcttcgccagccaggtccgaaccggacagacggtgttcgtg
tttgacgcagagagacgtcgactggaaccagtgtgcgtaaagcggatttttacgcatgaa
tacgagggctcttttgcaccggtgaccgtgcagggaaccgtggtggtggaccaggtcctt
gcgtcctgttacgcagtgatccaggaccacgatctggcgcactgggctttggcaccagtc
cggttcttctactgggtgaactcgttgcttttccagcgtccaaccagtgcccaaaccgat
ggggtgcactggtactccaagatccttttccagttaggaacatggctcttggacagccac
tcgatccatccacttgggatgtcagtatacacgagttga

KEGG   Notothenia coriiceps (black rockcod): 104956876
Entry
104956876         CDS       T04920                                 

Gene name
dhh
Definition
(RefSeq) desert hedgehog protein
  KO
K11990  desert hedgehog
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104956876 (dhh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104956876 (dhh)
Peptidases and inhibitors [BR:ncc01002]
 Cysteine peptidases
  Family C46: hedgehog family
   104956876 (dhh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 104956876
NCBI-ProteinID: XP_010782736
UniProt: A0A6I9P3K4
LinkDB
Position
Unknown
AA seq 456 aa
MKQSWWARLAQLFLLAVWTCMWLVQGCGPGPGYGVRSRPRRLTAMHYKQSFPNFSENNLG
ASGRAEGKISRNSERFNELVCNYNPDIIFKDEENTNADRFMTKRCKDCLNRLAIAVMNQW
PGVHLRVTEAWDEDGHHPASSLHYEGRAVDITTDDRDTDKYGLLAQLAVEAGFDWVHYES
KYHIHCSVKADHSVAVEKGGCFPGWARVTVAGGVQKSLSSLALGDRVMALSATGKVVWSQ
VLLFLHQDQESWSTFLFLETEDGHRLALTPNHLLFFAPLCRHHSSEYQAQFASRAKTGDC
VLIHTAQGQVRPSRIISVSVEESVGVYAPLTEAGTVFVDGVLASSYALVEDHRLAHWAFG
PVRLLSSFNQLLLGETRKDHQTTDSETACTETPFHCSTLAYNADVYVNNDTLNKQDGQSQ
TLRMEMKEKQTSNVHWYARLLYRFGCILLDSSSFHP
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaaacagtcctggtgggcccgcctggcacagctcttcctgctcgctgtgtggacctgc
atgtggctggtccagggatgcgggccgggccctgggtatggtgtccgctcaaggcccagg
agactcacagccatgcactacaagcagtctttccccaacttctcagaaaacaatcttggt
gccagcgggagagcagagggcaagatctcacgcaactctgagcgcttcaatgaacttgtg
tgcaactacaatccagacatcatcttcaaagatgaggagaacaccaacgcagaccgcttc
atgactaagcgctgtaaggactgtttgaacaggttggcgatcgcagtgatgaaccagtgg
cccggggtacacttacgtgtgacggaggcctgggatgaggacggacaccaccctgccagc
tctctgcactacgaaggccgggccgtggatataaccactgacgacagagacacagacaag
tatggtcttctcgcccagctggctgtggaggccggctttgactgggtccactacgagtcc
aaatatcacatccactgctctgtaaaagctgatcactctgttgctgtggagaaagggggc
tgtttcccaggctgggcccgggtcactgttgctggaggggtgcagaagagcctgtcgtcc
ttggctcttggggacagagtcatggccctgtctgcgacgggcaaagtcgtgtggagccag
gtcctcttgtttctgcaccaggatcaagaaagctggtctacttttctgtttctggagaca
gaagatggtcatagattggccctcactccaaatcacttactctttttcgcccccctttgc
agacaccacagcagtgagtatcaggctcagtttgctagtagagccaaaacaggagattgt
gttctcatccatacagctcagggtcaagtgcgtccatcacggatcatctcagtttcagta
gaggagagtgtgggtgtgtatgcgcccttgacagaagctggaactgtgtttgttgatggg
gtcctggcatccagctatgccctggtggaggaccacagactcgcacactgggcatttgga
cctgtgcgactcctctcctcattcaaccagctgcttttgggggagacaaggaaagaccac
cagaccacagacagtgagacagcttgcactgagactccatttcattgtagcactttggca
tacaacgcagacgtgtatgtgaataatgacactctgaacaaacaagatggtcagagtcaa
actctgaggatggaaatgaaagagaagcagacatcaaatgtgcactggtatgctagatta
ctataccgtttcggatgtatcttgttagactcaagctcatttcatccttaa

KEGG   Notothenia coriiceps (black rockcod): 104963304
Entry
104963304         CDS       T04920                                 

Definition
(RefSeq) indian hedgehog B protein-like
  KO
K11989  indian hedgehog
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104963304
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ncc01002]
    104963304
Peptidases and inhibitors [BR:ncc01002]
 Cysteine peptidases
  Family C46: hedgehog family
   104963304
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 104963304
NCBI-ProteinID: XP_010790179
UniProt: A0A6I9PH45
LinkDB
Position
Unknown
AA seq 438 aa
MRISFILLTTSLCALVLLLAPVSEGCGPGRGYGKRRLPKKLIPLDYKQFSPKVAEKTLGA
SGRPEGKITRNSERFKELTPNYNTDIIFKDEEDTGADRLMTQRCKDKLNSLAISVMNMWP
GVKLRVTEGWDEDGHHSEDSLHYEGRALDITTSDRDRNKYGMLARLAVEAGFDWVYYESK
AHIHCSVKSEHSVAAKTGGCFPGDAQVILQGGATKQMRDLLPGDRVLASSTTDGHGSLLY
SPVLSFLDHQPNITKIFYIIGTNRGLNITLTAAHLIFVTDCSGEQSEPKWDKTADGPPLK
GSIQKDRPRWEADLRTVFASEVQPGQCVLISQGKVGSHAELSVVNFVEEQRNTGLYAPLT
QHGSIVVNGVLASCYAAVDNHHLAHWALAPLRVFYSLIGPSEPQTDGLHWYTWLLQRLGQ
MLLGAGHFHPLGIEQAQR
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcggatctccttcatcctcctcaccacctctctgtgtgccttggtcctcctcctcgca
cctgtctcggagggctgcgggccggggagggggtacggcaagaggcggctcccgaagaag
ctcatcccgcttgactacaagcaattcagccccaaggtagccgagaagaccctgggagcc
agcgggagacccgagggtaaaataacgcgcaactccgagcgctttaaagaactcacgccg
aattacaacacagatattatcttcaaagatgaggaggacacgggggctgacaggctcatg
acccagcgttgcaaagacaagttaaactctctggccatctctgtgatgaacatgtggcca
ggtgttaagctgagagtgactgagggctgggatgaggatggtcatcattcagaagactcg
ttgcactatgagggacgtgctttggatatcaccacatcagacagggacagaaacaagtat
ggcatgttggcccggctggcagtagaagctggatttgactgggtctactacgagtccaaa
gcccacattcactgtagcgttaagtcagaacattctgttgccgccaaaaccggtggctgt
ttccctggcgatgctcaggttatcctccagggcggggctactaaacagatgcgtgacctt
ctccctggtgaccgagtcttggcctcttcaacgacagatggtcacggctccctgctctac
agtccggtcctgtccttcctggaccaccagcccaacatcacaaagatcttttacatcatt
ggcaccaacagaggacttaatattactctcacagccgctcacctgatctttgtcacagac
tgcagtggtgagcagagtgagccaaagtgggacaagacagctgatgggccgccactaaag
ggctccatacaaaaggacagacctcgctgggaagcagatctgaggacagtgtttgccagt
gaagtccagcctggacagtgtgtacttatatcacaagggaaagtgggctcacatgcagaa
ctttctgtagtgaactttgtagaagaacagaggaacaccgggctgtatgccccactaacc
cagcatggctccatagtggtgaatggtgtgctagcatcctgctatgcggctgtggacaat
caccatttggcccactgggcccttgccccactgagggtcttctacagcctgatcggaccc
tcagaacctcagactgatggcctgcactggtacacttggcttctacagaggctggggcaa
atgctattgggtgctggacacttccaccccttggggatcgagcaagcacaaagatag

DBGET integrated database retrieval system