KEGG   Notothenia coriiceps (black rockcod): 104949722
Entry
104949722         CDS       T04920                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04010  MAPK signaling pathway
ncc04060  Cytokine-cytokine receptor interaction
ncc04068  FoxO signaling pathway
ncc04144  Endocytosis
ncc04218  Cellular senescence
ncc04350  TGF-beta signaling pathway
ncc04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104949722
   04350 TGF-beta signaling pathway
    104949722
   04068 FoxO signaling pathway
    104949722
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104949722
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104949722
  09143 Cell growth and death
   04218 Cellular senescence
    104949722
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104949722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ncc01001]
    104949722
Enzymes [BR:ncc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     104949722
Protein kinases [BR:ncc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   104949722
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 104949722
NCBI-ProteinID: XP_010774432
UniProt: A0A6I9ND14
LinkDB
Position
Unknown
AA seq 568 aa
METQKQGDVGVLERFLDPTPDDPLVSVLLVSLVPLVVMGIVVVGMFHWYRAYRQRGIREW
ESNIKKRKPKAAGLDCDACAIMMDDDGSDSSSTHANSLNHNTEPLPIELELLVGKGRFAQ
VYKAKLKQSTSDQFETVAVKIFPYEEYASWKNEKDIFSNTDLRHENVLHFLTAEERKVEK
QYWIITAFHHRGNLQEHLTRHVISWEELQVLGMSLSQGVAHLHSDRLLCGRPKVPIVHRD
LKSSNILVKNDLTLCLSDFGLALRLDSCLTVDDLANSGQVGTARYMAPEVLEARLNLENM
ESFKQTDIYSMALVLWEMTSRCEAIGVASPDDSSAGGPANPMSCCRFGGSTPTTLSAAGV
PSNSMSCSALGVPPDYFFPGSCQPYVPFRWMGPAESSCQLYVLSRWRSRNLLSCGGPANP
TACLPLGVLPTTFLAGGPANPLFLVPLEWPAHHLSPPGRSCNLVLFRGGSCQRLVPVTAE
ASLSPLRFLFVRRHRVSCPASGAVVSRPSRAVPLSARVFAPRPAPRVTRLWPSGTRPPDS
SCRAGPLALGPGRLTLSCRCLRPSCSAP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagacacagaaacagggagatgttggagtgctggagagatttttggatccaacccca
gacgaccccctggtgtcggttctgctggtgagcctggtgcctctggtggtgatggggatt
gtggttgtgggaatgttccactggtaccgagcctatcggcagcgcgggatccgagaatgg
gagagcaacattaagaagcgcaagcccaaagctgcggggctggactgcgacgcctgcgcc
atcatgatggatgacgacggatcggacagcagctccacgcacgccaacagcctcaaccac
aacacagagccgctgcctatagagctggaactgctggtggggaagggtcgcttcgcccag
gtgtacaaggccaagctgaagcagagcacctcagatcagtttgaaacagtcgctgtgaag
atcttcccctacgaggaatacgcctcctggaagaacgagaaggacattttctccaacaca
gacctgcgacacgaaaatgtcctccatttcctgacagctgaggagaggaaggtggagaaa
cagtactggatcatcacggccttccaccacagaggaaatctacaggagcacctgacgcgt
catgtgatcagctgggaggagctgcaggtgctgggcatgtctctgtcccagggggtggcc
cacctccacagtgaccgcctgctctgtggacggcctaaggtgcccatagtgcatcgggac
ctgaagagctccaacatcctggtgaagaacgacctgacgctgtgcctcagtgacttcggg
ctggctctccgtttggacagctgtctgactgtggatgacctcgccaacagtggacaggtg
ggcacggcacgctacatggctccggaggtgctggaggcccgactgaatctggagaacatg
gagtccttcaaacagacggacatttactccatggccctggtgctttgggagatgacttcg
aggtgtgaagctatcggagtcgcctcgccggacgattcttctgccgggggtcctgccaac
cctatgtcctgctgtcgttttggagggtccacgccaacaactctttccgctgcgggcgtc
ccttccaactccatgtcctgctccgcgttgggggtcccgcccgactacttcttcccgggg
tcctgccaaccctatgtccccttccgttggatgggtcccgctgagagttcctgccaactc
tatgtcctgtcccgttggaggtcccgcaacttactctcctgcgggggtcctgccaatcct
actgcctgcttacctctgggggtcctgccgacaacctttctggccgggggacctgccaac
cccttgttcctggttccgttggagtggcccgcccatcacctgtctccgccggggcggtcc
tgcaatctggtcctcttccgtgggggatcctgccaacgcctggtccccgtgaccgccgaa
gcgagcctgtccccgctccggttcctgttcgtccgccgacaccgggtttcctgcccggcc
tccggagctgtcgtctctcgcccgtcgagagccgtccccctgagtgcccgcgtcttcgcc
cctcgacccgcaccccgagtgacgcgtctctggccctcgggcacccggccccctgactct
tcctgccgggccggtcctctcgccctcggccctggccgcctgactctttcctgccgctgc
cttcgcccctcatgctcggccccctga

DBGET integrated database retrieval system