KEGG   Notothenia coriiceps (black rockcod): 104949822Help
Entry
104949822         CDS       T04920                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc00052  Galactose metabolism
ncc00500  Starch and sucrose metabolism
ncc01100  Metabolic pathways
ncc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104949822
   00500 Starch and sucrose metabolism
    104949822
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104949822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ncc04147]
    104949822
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104949822
Exosome [BR:ncc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104949822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104949822
NCBI-ProteinID: XP_010774540
LinkDB All DBs
Position
Unknown
AA seq 975 aa AA seqDB search
MVSYKLLNPEDVQFSSAVLSEEPVREEHPVREPEEASLLPRRRGCSGTTALLVIGCLLLL
LCGGWVLGTMFWLHRPSSTQPYRRPSPASGHAPDSRVETGVNDTAAAVSRREACSLIPEA
WRFDCYPERGVVVTRELCEARNCCFIPASSPSSSASRPSGRNGIPWCFYPEDFPSYSLVS
MNDTSLGQKGTLVREVKTYYPADILTLEVEIRHETDSRLRVRITDPANSRFEVPISVPAA
TKKADSPEYIVEISKQPFGLIVKRRSTGAVLLNTTVAPLLFADQFLQLSSSLQSQFIYGL
GEHRSSFLHDVHWNTLTMWARDVPPTEQTNLYGAHPFYLAMEEGGDAHGFFLLNSNAMDV
ALQPAPALTWRTIGGILDFYVFLGPDPASVIGQYVEVIGYPAMPIYWALGYHLCRWGYNT
SDSTWEMVKSLRNYKIPQDVQWNDIDYMDQFMDFTFDSKTFGTLPDMVKDLHVHDQRYVM
ILDPGISSSQPEGSYWPYDEGLKRDVFIKDAEGKTLIGKVWPGLTAYPDFSNEVTHEWWY
ENLLRFHEKVPFDGLWIDMNEPSNFVDGSTNGCPSNSLENPPYTPGILGGLLRAKTLCAT
AQQKQSIHYNMHSLYGLMEAKASASAMKRIVAKRPFVISRSTFPSQGMYSGHWLGDNRSQ
WKDMYTSIAGMLTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFTRNHNAIDMR
PQDPTAFSPLARTAMKQALLLRYSLFPVLYTLFHHAHVHGHTVARPLMFEFPKDVKTYGI
DKQFLWGKSLLVTPVLDPEVDYVDGYFPEGLWYDYYTGDSLHSQGEDLRLNAPLDKINLH
LREGSITPTQAPNLTLWVSSGQPLHLVTALSEGGAASGDLFWDDGETIDTYENNLYSYIL
FSVAQNVMTSQVLHSNVEATYITVETASFYGVKQKPSRVTVNSQDATFTYRDNQVLTVAD
LGLNLSQNFTISWMF
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtacaagctgctgaaccctgaagatgtgcagttttccagtgccgttctgtcc
gaagagccggtccgggaagaacatccagtgcgtgagccagaggaagcgtcgctgctccct
cggcgccgtggctgctccggcaccacggcgctgctggtgatcggctgcctgctgctgctg
ctctgtggaggctgggtgctgggcaccatgttctggctgcaccgtccctccagcacccag
ccgtacagacgtccgtcaccggcctctggacacgctccagactctcgagtagaaacggga
gtaaacgacactgcagcagccgtttcccgccgcgaggcctgcagcttaatccccgaggcg
tggaggttcgactgctacccagagagaggggtggttgtgacccgagagctgtgtgaggcg
aggaactgttgcttcatcccagcatcctctccctcctcctctgcatcccgcccatcaggg
aggaacggcatcccgtggtgtttctaccccgaggacttcccttcatactcgcttgtgtcg
atgaatgacacatcgctgggacaaaaagggacgctcgtacgggaggtgaagacctactac
cctgcggacatcctcactctagaggtggagatacgacacgagacggactcaagactacga
gtcaggattaccgacccggctaattctcggttcgaggttcccatctccgttcccgctgcc
acgaagaaagcagacagtccagaatacatcgtggagatttccaagcaaccgtttggtctc
atcgtgaagaggagatctacaggagcagtgcttctgaacaccacggtggctcctctcctc
ttcgcggatcagttcctccagctctcctcctccctgcagagtcagttcatctacgggctg
ggagagcatcgatcctccttcctgcacgacgtgcactggaacacgctcaccatgtgggcc
agggacgtgccccccacggaacagaccaacctgtatggagctcatccattttacctggcc
atggaggaggggggggacgcacacggcttcttcctgctgaacagcaacgccatggatgtg
gccctgcagccggcccccgccctcacctggcgcaccattggaggaatccttgacttttac
gtcttcctcgggcctgatcctgcttcagtgattggacagtatgtggaagtcatcggttac
ccagcgatgcccatctactgggctttaggctaccatctctgtcgctggggctacaacacg
agcgactccacctgggagatggtcaagagcctgaggaattataaaataccccaggacgtc
cagtggaacgacatcgactacatggatcagttcatggacttcacctttgactccaaaacg
ttcggcacactgcccgacatggtgaaagatttgcatgttcatgaccagcgctacgtcatg
attctggaccccgggatcagcagctctcagcctgagggatcttactggccgtacgacgag
gggctgaagagagacgtctttattaaagacgccgaaggaaagacactcatcgggaaggtg
tggccgggtctcacagcttatcctgatttctcgaatgaagtgactcatgaatggtggtac
gaaaaccttctgaggttccatgagaaggtgccatttgatgggttatggattgacatgaat
gagccgtcaaatttcgtggatggatctactaatggctgtccttcaaacagtctggagaat
cctccttacacacctggtatactaggaggtttgctccgagccaaaactttgtgtgccact
gcccagcagaagcagtccattcactacaatatgcacagcctctatggactcatggaagct
aaggcgtctgcaagcgccatgaagcggatcgtggcgaagagaccgtttgtgatctctcgc
tccaccttcccctctcagggcatgtactccggtcactggctgggagacaacaggagccag
tggaaagacatgtacacttctatagcaggtatgttgacctttaacctcctgggcatccct
ctggtgggggcagatatctgtggtttcagcgaggagccgcaggaggagctgtgtgtccgc
tggacgcagctgggagctttctaccccttcacacgcaaccacaacgccatcgacatgcgg
cctcaggaccccacagcgttcagccctctggctcggacagcgatgaagcaggctctgctg
ctgcgatactctctcttccccgtcctctacacactcttccatcacgcacatgttcacgga
cacactgtcgcacggccgctcatgtttgagtttccaaaagatgtgaaaacctacgggatc
gacaaacagttcctgtgggggaagagtttgttggtgacaccagtgctggatcctgaagtg
gactatgtggacggatacttcccagagggtctgtggtatgactactacacgggcgactct
ctgcacagtcagggggaagaccttcgactgaacgctcctctggataagatcaacctgcat
ctgcgtgagggctccattactccaacacaggcgcccaacctgacgctgtgggtgagcagc
gggcagccgctccacctggtgacggcgctctctgagggcggagcggccagcggggatctg
ttctgggacgacggagagaccatcgacacctacgagaacaacctgtactcctacatcctg
ttcagcgtcgctcagaacgtgatgacgtcacaggttctgcatagcaacgtggaggcaacc
tacatcaccgtggagacggcctccttctacggcgtgaagcagaaaccgagcagagtgacg
gtgaactcccaagatgcaacgttcacctacagagacaaccaggtgttaacagttgcagat
ctcggtctcaacctcagtcagaacttcaccatcagctggatgttttga

DBGET integrated database retrieval system